Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NV52

Protein Details
Accession C0NV52    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-60ETNKTNKKEKREHRLDPPKIBasic
NLS Segment(s)
PositionSequence
29-54GARWRRAELKPGETNKTNKKEKREHR
Subcellular Location(s) cyto 11, nucl 4, mito 4, cysk 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MGLDPALPFMRNLDEVAHMDIPSAWAKAGARWRRAELKPGETNKTNKKEKREHRLDPPKILLVGWFEITRSPFVLGQETAEFFDRGACRYASELLRWGMQLKEDQLCITCGGIGGISGNFKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.21
4 0.21
5 0.17
6 0.17
7 0.16
8 0.17
9 0.15
10 0.13
11 0.09
12 0.1
13 0.1
14 0.14
15 0.24
16 0.29
17 0.33
18 0.36
19 0.4
20 0.47
21 0.48
22 0.53
23 0.48
24 0.49
25 0.52
26 0.53
27 0.54
28 0.5
29 0.56
30 0.56
31 0.6
32 0.61
33 0.58
34 0.63
35 0.68
36 0.72
37 0.77
38 0.76
39 0.73
40 0.75
41 0.81
42 0.76
43 0.7
44 0.62
45 0.52
46 0.43
47 0.38
48 0.27
49 0.18
50 0.15
51 0.11
52 0.09
53 0.08
54 0.09
55 0.1
56 0.1
57 0.08
58 0.09
59 0.09
60 0.1
61 0.12
62 0.11
63 0.12
64 0.12
65 0.12
66 0.12
67 0.12
68 0.12
69 0.09
70 0.13
71 0.12
72 0.13
73 0.15
74 0.14
75 0.13
76 0.15
77 0.19
78 0.17
79 0.17
80 0.2
81 0.19
82 0.2
83 0.19
84 0.19
85 0.16
86 0.16
87 0.17
88 0.17
89 0.18
90 0.18
91 0.19
92 0.18
93 0.18
94 0.17
95 0.15
96 0.12
97 0.09
98 0.09
99 0.08
100 0.07
101 0.07
102 0.07
103 0.08