Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B301

Protein Details
Accession A0A1G4B301    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
139-160AMPKLIKEWKKVGKKNWTRFPKHydrophilic
NLS Segment(s)
PositionSequence
117-160VKGKIHERMVQPRMEKRREAMLAMPKLIKEWKKVGKKNWTRFPK
Subcellular Location(s) mito 15.5, cyto_mito 11, cyto 5.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MAAAEQYIQLAKSLPQQLQRFFARWPPAAILPHNATTPKTGFQELTANPFAPQKHPATGKWHDPVYSLRRQAEIVKLARQHGVEELLPSTVKGTEYRIAHRVEHGLRVKGTGVGQKVKGKIHERMVQPRMEKRREAMLAMPKLIKEWKKVGKKNWTRFPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.33
3 0.38
4 0.4
5 0.46
6 0.48
7 0.42
8 0.39
9 0.43
10 0.41
11 0.37
12 0.37
13 0.34
14 0.34
15 0.36
16 0.35
17 0.34
18 0.3
19 0.3
20 0.29
21 0.27
22 0.23
23 0.24
24 0.24
25 0.22
26 0.21
27 0.21
28 0.19
29 0.2
30 0.26
31 0.23
32 0.27
33 0.25
34 0.23
35 0.22
36 0.25
37 0.24
38 0.2
39 0.24
40 0.2
41 0.24
42 0.26
43 0.28
44 0.33
45 0.36
46 0.39
47 0.38
48 0.37
49 0.32
50 0.31
51 0.34
52 0.32
53 0.35
54 0.32
55 0.3
56 0.3
57 0.3
58 0.31
59 0.29
60 0.28
61 0.24
62 0.24
63 0.24
64 0.25
65 0.26
66 0.24
67 0.2
68 0.15
69 0.15
70 0.11
71 0.11
72 0.1
73 0.08
74 0.08
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.09
81 0.14
82 0.16
83 0.19
84 0.23
85 0.24
86 0.24
87 0.24
88 0.27
89 0.23
90 0.29
91 0.29
92 0.28
93 0.26
94 0.26
95 0.25
96 0.22
97 0.23
98 0.19
99 0.19
100 0.2
101 0.24
102 0.28
103 0.31
104 0.32
105 0.37
106 0.38
107 0.41
108 0.45
109 0.48
110 0.49
111 0.56
112 0.58
113 0.56
114 0.56
115 0.59
116 0.6
117 0.58
118 0.55
119 0.48
120 0.53
121 0.49
122 0.46
123 0.44
124 0.44
125 0.43
126 0.43
127 0.42
128 0.33
129 0.34
130 0.39
131 0.36
132 0.32
133 0.38
134 0.45
135 0.55
136 0.63
137 0.7
138 0.74
139 0.81
140 0.86