FuNGI

A0A1G4AM10

Protein Details

Accession

A0A1G4AM10

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
467-499	SSFSKDSPKHRWTRSVDRLRRHRTQIRRDSGPG	Hydrophilic

NLS Segment(s)

Position	Sequence
23-40	RHGAHRAAKLAAKERRRD

Subcellular Location(s)

plas 20, mito 3, E.R. 2, cyto_mito 2, mito_nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR008427 Extracellular_membr_CFEM_dom
Gene Ontology	GO:0016020 C:membrane
Pfam	View protein in Pfam PF05730 CFEM

Amino Acid Sequences

MAHTESKSTTLSLSQVARYRASRHGAHRAAKLAAKERRRDMGKSSAKCPPAANVSSYRTLPVYFIEYLPQQLGLQPQDASSASVETSVTPPPSSASASSRFPIGLSCAMSRRSSALAVLALQLAVAAAKATSAVEILSQVPSCASECISSTFMTSACDPEDVTTCICLNIATQSELSTSAAAVEGVLCEAYPKASRRTEVRQTLIISCSLVLFIVTLRLFTSRRYAGGLWRDDYMTILAAALLIALAAVYLHITSIGFGMHYWTIPVGNGVVIRKMLYVGNLIYIVLQAAVKLSIVLFLGRIFPSETFRRIAQGIQIILLLHGTLFTIPFATQCVPVQSIWDRTITDRRCLNLQAVGYSSGGLAMAEDVAILLLPIPYVWRLKISLQRRLAVIALFSVGSFACVTSAVRVRYLVEYSTTFDETWDHVDIVVWSFIEQSTAMLCASLPSLRLLLVSVWCRRRSASSESSFSKDSPKHRWTRSVDRLRRHRTQIRRDSGPGPQHTGDGVLVTTTVEVDRQSYVAPDVPPFPPPAYSGRSNYT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.26
2	0.31
3	0.33
4	0.36
5	0.37
6	0.39
7	0.41
8	0.45
9	0.46
10	0.48
11	0.56
12	0.59
13	0.63
14	0.63
15	0.6
16	0.58
17	0.55
18	0.53
19	0.52
20	0.53
21	0.55
22	0.57
23	0.59
24	0.64
25	0.65
26	0.63
27	0.59
28	0.62
29	0.63
30	0.61
31	0.6
32	0.59
33	0.57
34	0.55
35	0.5
36	0.45
37	0.43
38	0.41
39	0.4
40	0.38
41	0.4
42	0.42
43	0.41
44	0.37
45	0.3
46	0.28
47	0.25
48	0.2
49	0.2
50	0.18
51	0.18
52	0.19
53	0.19
54	0.2
55	0.2
56	0.19
57	0.14
58	0.14
59	0.19
60	0.17
61	0.18
62	0.17
63	0.16
64	0.18
65	0.18
66	0.17
67	0.13
68	0.12
69	0.1
70	0.11
71	0.11
72	0.1
73	0.11
74	0.13
75	0.14
76	0.13
77	0.13
78	0.14
79	0.16
80	0.17
81	0.18
82	0.19
83	0.22
84	0.24
85	0.25
86	0.24
87	0.22
88	0.2
89	0.19
90	0.17
91	0.17
92	0.16
93	0.18
94	0.2
95	0.23
96	0.23
97	0.23
98	0.22
99	0.2
100	0.18
101	0.16
102	0.15
103	0.13
104	0.13
105	0.13
106	0.11
107	0.09
108	0.08
109	0.07
110	0.05
111	0.04
112	0.04
113	0.03
114	0.02
115	0.02
116	0.03
117	0.03
118	0.03
119	0.04
120	0.04
121	0.04
122	0.05
123	0.06
124	0.08
125	0.08
126	0.08
127	0.08
128	0.09
129	0.09
130	0.09
131	0.09
132	0.08
133	0.09
134	0.12
135	0.14
136	0.13
137	0.13
138	0.13
139	0.12
140	0.13
141	0.13
142	0.11
143	0.1
144	0.11
145	0.1
146	0.1
147	0.13
148	0.12
149	0.12
150	0.12
151	0.11
152	0.11
153	0.11
154	0.1
155	0.07
156	0.09
157	0.1
158	0.1
159	0.1
160	0.1
161	0.1
162	0.11
163	0.11
164	0.09
165	0.07
166	0.06
167	0.06
168	0.06
169	0.05
170	0.04
171	0.03
172	0.03
173	0.03
174	0.03
175	0.03
176	0.03
177	0.05
178	0.09
179	0.11
180	0.17
181	0.19
182	0.22
183	0.27
184	0.35
185	0.43
186	0.46
187	0.47
188	0.44
189	0.44
190	0.44
191	0.4
192	0.32
193	0.23
194	0.16
195	0.13
196	0.1
197	0.07
198	0.05
199	0.04
200	0.03
201	0.07
202	0.06
203	0.06
204	0.07
205	0.09
206	0.1
207	0.11
208	0.16
209	0.14
210	0.14
211	0.17
212	0.17
213	0.2
214	0.27
215	0.28
216	0.24
217	0.24
218	0.24
219	0.21
220	0.21
221	0.16
222	0.09
223	0.07
224	0.05
225	0.04
226	0.04
227	0.04
228	0.03
229	0.02
230	0.02
231	0.02
232	0.01
233	0.01
234	0.01
235	0.01
236	0.02
237	0.02
238	0.02
239	0.02
240	0.02
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.05
247	0.05
248	0.05
249	0.05
250	0.05
251	0.05
252	0.05
253	0.05
254	0.04
255	0.04
256	0.05
257	0.06
258	0.06
259	0.06
260	0.06
261	0.06
262	0.07
263	0.07
264	0.06
265	0.07
266	0.06
267	0.07
268	0.07
269	0.07
270	0.06
271	0.05
272	0.05
273	0.04
274	0.04
275	0.03
276	0.03
277	0.03
278	0.03
279	0.03
280	0.03
281	0.03
282	0.04
283	0.04
284	0.04
285	0.04
286	0.06
287	0.06
288	0.07
289	0.07
290	0.08
291	0.12
292	0.14
293	0.16
294	0.16
295	0.16
296	0.18
297	0.18
298	0.18
299	0.16
300	0.17
301	0.15
302	0.13
303	0.13
304	0.11
305	0.1
306	0.1
307	0.07
308	0.04
309	0.03
310	0.03
311	0.03
312	0.03
313	0.03
314	0.04
315	0.04
316	0.04
317	0.06
318	0.07
319	0.08
320	0.09
321	0.11
322	0.11
323	0.11
324	0.14
325	0.15
326	0.18
327	0.18
328	0.18
329	0.17
330	0.19
331	0.28
332	0.27
333	0.3
334	0.29
335	0.29
336	0.31
337	0.31
338	0.3
339	0.24
340	0.23
341	0.18
342	0.17
343	0.17
344	0.14
345	0.13
346	0.11
347	0.08
348	0.07
349	0.06
350	0.04
351	0.03
352	0.03
353	0.03
354	0.03
355	0.02
356	0.02
357	0.02
358	0.02
359	0.02
360	0.02
361	0.02
362	0.02
363	0.03
364	0.05
365	0.07
366	0.08
367	0.09
368	0.11
369	0.16
370	0.25
371	0.31
372	0.38
373	0.41
374	0.43
375	0.42
376	0.41
377	0.37
378	0.3
379	0.23
380	0.14
381	0.11
382	0.08
383	0.08
384	0.07
385	0.06
386	0.06
387	0.06
388	0.05
389	0.05
390	0.05
391	0.06
392	0.09
393	0.14
394	0.14
395	0.15
396	0.16
397	0.17
398	0.19
399	0.2
400	0.17
401	0.15
402	0.15
403	0.17
404	0.2
405	0.2
406	0.17
407	0.16
408	0.17
409	0.16
410	0.18
411	0.17
412	0.14
413	0.13
414	0.13
415	0.14
416	0.14
417	0.13
418	0.09
419	0.08
420	0.08
421	0.08
422	0.08
423	0.08
424	0.06
425	0.06
426	0.07
427	0.07
428	0.06
429	0.06
430	0.06
431	0.07
432	0.08
433	0.08
434	0.08
435	0.09
436	0.09
437	0.09
438	0.09
439	0.1
440	0.14
441	0.18
442	0.25
443	0.31
444	0.33
445	0.34
446	0.35
447	0.38
448	0.39
449	0.42
450	0.45
451	0.45
452	0.5
453	0.52
454	0.54
455	0.51
456	0.46
457	0.46
458	0.42
459	0.43
460	0.46
461	0.52
462	0.58
463	0.62
464	0.71
465	0.71
466	0.76
467	0.8
468	0.82
469	0.8
470	0.82
471	0.87
472	0.85
473	0.86
474	0.84
475	0.83
476	0.82
477	0.85
478	0.85
479	0.83
480	0.81
481	0.77
482	0.72
483	0.71
484	0.7
485	0.63
486	0.59
487	0.51
488	0.45
489	0.4
490	0.38
491	0.29
492	0.21
493	0.16
494	0.09
495	0.09
496	0.08
497	0.08
498	0.06
499	0.07
500	0.07
501	0.07
502	0.09
503	0.1
504	0.1
505	0.11
506	0.11
507	0.14
508	0.17
509	0.18
510	0.19
511	0.22
512	0.23
513	0.25
514	0.26
515	0.25
516	0.22
517	0.24
518	0.27
519	0.29
520	0.34

A0A1G4AM10

3D AlphaFold-predicted Structure Viewer