Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4BRZ8

Protein Details
Accession A0A1G4BRZ8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
314-339GADCEKSAARRRARSMRRKLARGASYHydrophilic
NLS Segment(s)
PositionSequence
322-335ARRRARSMRRKLAR
Subcellular Location(s) extr 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MRSFAVLAAAALVPQAMAHYVFPTLIVNGEQTERYQYVREAKNSNSPVTDVTSDGIVCNIGGNDDDVLAKTQTKAVKAGDEVGFMVENDLGHPGPLAVYLSKAPSTVATYKGDGDWFKVYELSTSSITDAGLQWATYINNAGIHNFTFTLPKEVPTGEYLMRVEHIALHGAGTKGGAQFYIECAQISVTGTSTKTPSPTVKFPGAYTGEEPGLLINIYYPAPKNYTAPGPTVAFSGCEDHTANLLGQTSDGDCTGSDGATTPTTPTTPTTPSTPAAPSAAIPDYNGGNSTTPAEPSTPSAAAPPSAAAPSTPAGADCEKSAARRRARSMRRKLARGASY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.08
7 0.08
8 0.08
9 0.09
10 0.1
11 0.09
12 0.09
13 0.09
14 0.09
15 0.1
16 0.13
17 0.13
18 0.13
19 0.17
20 0.17
21 0.18
22 0.2
23 0.23
24 0.3
25 0.36
26 0.41
27 0.41
28 0.43
29 0.51
30 0.53
31 0.51
32 0.43
33 0.37
34 0.33
35 0.32
36 0.3
37 0.21
38 0.18
39 0.17
40 0.15
41 0.14
42 0.12
43 0.09
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.09
55 0.09
56 0.1
57 0.1
58 0.14
59 0.16
60 0.18
61 0.2
62 0.19
63 0.22
64 0.22
65 0.27
66 0.23
67 0.21
68 0.2
69 0.17
70 0.16
71 0.13
72 0.13
73 0.08
74 0.07
75 0.06
76 0.08
77 0.07
78 0.07
79 0.07
80 0.06
81 0.05
82 0.06
83 0.06
84 0.05
85 0.06
86 0.07
87 0.09
88 0.09
89 0.09
90 0.09
91 0.09
92 0.14
93 0.15
94 0.17
95 0.18
96 0.18
97 0.19
98 0.19
99 0.21
100 0.17
101 0.17
102 0.16
103 0.15
104 0.14
105 0.14
106 0.14
107 0.12
108 0.14
109 0.13
110 0.12
111 0.12
112 0.12
113 0.11
114 0.11
115 0.11
116 0.09
117 0.08
118 0.07
119 0.07
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.06
126 0.09
127 0.09
128 0.1
129 0.09
130 0.09
131 0.1
132 0.1
133 0.1
134 0.09
135 0.1
136 0.14
137 0.13
138 0.14
139 0.15
140 0.14
141 0.15
142 0.14
143 0.16
144 0.11
145 0.12
146 0.12
147 0.11
148 0.11
149 0.09
150 0.08
151 0.06
152 0.06
153 0.06
154 0.05
155 0.05
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.05
165 0.05
166 0.07
167 0.09
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.09
174 0.07
175 0.06
176 0.07
177 0.07
178 0.08
179 0.09
180 0.1
181 0.1
182 0.13
183 0.17
184 0.2
185 0.23
186 0.27
187 0.29
188 0.29
189 0.28
190 0.31
191 0.29
192 0.26
193 0.23
194 0.21
195 0.17
196 0.16
197 0.16
198 0.1
199 0.08
200 0.06
201 0.05
202 0.03
203 0.05
204 0.05
205 0.06
206 0.07
207 0.08
208 0.11
209 0.12
210 0.13
211 0.15
212 0.2
213 0.2
214 0.21
215 0.22
216 0.21
217 0.21
218 0.2
219 0.18
220 0.13
221 0.13
222 0.14
223 0.11
224 0.12
225 0.12
226 0.12
227 0.13
228 0.13
229 0.12
230 0.1
231 0.11
232 0.09
233 0.08
234 0.08
235 0.08
236 0.08
237 0.08
238 0.07
239 0.06
240 0.08
241 0.08
242 0.07
243 0.07
244 0.07
245 0.09
246 0.09
247 0.1
248 0.09
249 0.1
250 0.1
251 0.12
252 0.13
253 0.15
254 0.17
255 0.19
256 0.22
257 0.24
258 0.25
259 0.27
260 0.26
261 0.24
262 0.22
263 0.2
264 0.17
265 0.17
266 0.18
267 0.15
268 0.14
269 0.14
270 0.14
271 0.14
272 0.14
273 0.12
274 0.11
275 0.11
276 0.14
277 0.14
278 0.14
279 0.15
280 0.15
281 0.15
282 0.18
283 0.21
284 0.18
285 0.18
286 0.19
287 0.19
288 0.19
289 0.18
290 0.15
291 0.12
292 0.13
293 0.13
294 0.1
295 0.12
296 0.12
297 0.13
298 0.12
299 0.11
300 0.14
301 0.16
302 0.17
303 0.15
304 0.18
305 0.19
306 0.24
307 0.34
308 0.39
309 0.46
310 0.53
311 0.61
312 0.68
313 0.77
314 0.83
315 0.84
316 0.86
317 0.88
318 0.86
319 0.85