Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4BBG7

Protein Details
Accession A0A1G4BBG7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MANPPRKKYFCMACHKKQKQEANFPRSRPQPKPRQDREIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 4
Family & Domain DBs
Amino Acid Sequences MANPPRKKYFCMACHKKQKQEANFPRSRPQPKPRQDREIAGTAMSAGDLYRYLPLDPNESNRSTKPCQCLSTLRCREWGYPLVFVSLAPMHPGQHICCPQLQLVSRSMSPFILLFFSSSSSTTTTPHAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.84
4 0.83
5 0.84
6 0.82
7 0.84
8 0.84
9 0.82
10 0.81
11 0.76
12 0.75
13 0.74
14 0.73
15 0.71
16 0.7
17 0.71
18 0.75
19 0.82
20 0.82
21 0.82
22 0.78
23 0.74
24 0.68
25 0.63
26 0.53
27 0.42
28 0.33
29 0.24
30 0.2
31 0.14
32 0.09
33 0.04
34 0.03
35 0.03
36 0.04
37 0.05
38 0.06
39 0.06
40 0.09
41 0.1
42 0.14
43 0.15
44 0.2
45 0.22
46 0.24
47 0.25
48 0.24
49 0.29
50 0.28
51 0.32
52 0.32
53 0.32
54 0.32
55 0.33
56 0.39
57 0.37
58 0.45
59 0.46
60 0.42
61 0.43
62 0.43
63 0.41
64 0.38
65 0.4
66 0.31
67 0.27
68 0.26
69 0.23
70 0.21
71 0.19
72 0.17
73 0.12
74 0.1
75 0.1
76 0.1
77 0.09
78 0.11
79 0.13
80 0.13
81 0.19
82 0.22
83 0.22
84 0.23
85 0.24
86 0.23
87 0.27
88 0.28
89 0.24
90 0.24
91 0.26
92 0.26
93 0.25
94 0.25
95 0.2
96 0.18
97 0.16
98 0.13
99 0.12
100 0.11
101 0.1
102 0.1
103 0.12
104 0.12
105 0.13
106 0.13
107 0.14
108 0.15
109 0.16