Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NRJ5

Protein Details
Accession C0NRJ5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-105IENDKPTDPKPKPKPKPKPKKTVGQKVLDBasic
NLS Segment(s)
PositionSequence
85-98PKPKPKPKPKPKKT
Subcellular Location(s) extr 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
Amino Acid Sequences MRFSTFSLALLLGSVVSATPAVELFERKVGSSCKTMDGMGTCMARSKCTGVYYDGACGKNSGETRTCPAGKDVQCCIENDKPTDPKPKPKPKPKPKKTVGQKVLDIAMKEKGTKYVWGGGSCKGPTKGGYDCSGLVAYAVCKATKRNLFKEGLRVTYSMYCASSSRLGKFNNSGDRMLHAPNPSTVVREGKVSAQGSLKACPYVIRFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.06
9 0.07
10 0.09
11 0.11
12 0.15
13 0.16
14 0.16
15 0.2
16 0.21
17 0.24
18 0.27
19 0.26
20 0.25
21 0.26
22 0.25
23 0.24
24 0.23
25 0.21
26 0.2
27 0.19
28 0.16
29 0.21
30 0.21
31 0.2
32 0.19
33 0.2
34 0.19
35 0.2
36 0.22
37 0.19
38 0.23
39 0.22
40 0.25
41 0.27
42 0.25
43 0.24
44 0.22
45 0.2
46 0.21
47 0.22
48 0.21
49 0.18
50 0.19
51 0.24
52 0.3
53 0.3
54 0.26
55 0.27
56 0.31
57 0.32
58 0.35
59 0.32
60 0.31
61 0.31
62 0.31
63 0.35
64 0.31
65 0.3
66 0.29
67 0.31
68 0.3
69 0.33
70 0.42
71 0.4
72 0.45
73 0.53
74 0.62
75 0.67
76 0.74
77 0.82
78 0.84
79 0.92
80 0.92
81 0.92
82 0.87
83 0.87
84 0.86
85 0.86
86 0.82
87 0.75
88 0.66
89 0.57
90 0.53
91 0.44
92 0.34
93 0.24
94 0.19
95 0.15
96 0.14
97 0.13
98 0.13
99 0.13
100 0.14
101 0.14
102 0.17
103 0.19
104 0.2
105 0.21
106 0.2
107 0.23
108 0.22
109 0.23
110 0.18
111 0.17
112 0.16
113 0.18
114 0.19
115 0.18
116 0.2
117 0.19
118 0.18
119 0.19
120 0.17
121 0.14
122 0.11
123 0.09
124 0.07
125 0.08
126 0.09
127 0.08
128 0.08
129 0.1
130 0.18
131 0.26
132 0.32
133 0.34
134 0.4
135 0.44
136 0.46
137 0.54
138 0.5
139 0.45
140 0.41
141 0.36
142 0.32
143 0.3
144 0.3
145 0.21
146 0.18
147 0.15
148 0.14
149 0.17
150 0.21
151 0.21
152 0.23
153 0.28
154 0.28
155 0.31
156 0.36
157 0.41
158 0.43
159 0.43
160 0.41
161 0.36
162 0.38
163 0.37
164 0.34
165 0.31
166 0.25
167 0.23
168 0.23
169 0.27
170 0.24
171 0.24
172 0.25
173 0.25
174 0.23
175 0.24
176 0.24
177 0.23
178 0.3
179 0.28
180 0.28
181 0.26
182 0.31
183 0.3
184 0.32
185 0.31
186 0.25
187 0.24
188 0.25