Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AM40

Protein Details
Accession A0A1G4AM40   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20SDKLNYKKLKPFKIIKKVLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences SDKLNYKKLKPFKIIKKVLLINFKLKLLNTIRYYSVFYILLLKLIFKSLYTKNRIIVEFNKLKYKIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.74
4 0.71
5 0.68
6 0.66
7 0.58
8 0.53
9 0.47
10 0.44
11 0.37
12 0.31
13 0.31
14 0.26
15 0.3
16 0.26
17 0.27
18 0.26
19 0.26
20 0.28
21 0.22
22 0.21
23 0.14
24 0.12
25 0.13
26 0.12
27 0.12
28 0.11
29 0.11
30 0.09
31 0.1
32 0.1
33 0.07
34 0.12
35 0.18
36 0.26
37 0.32
38 0.34
39 0.38
40 0.43
41 0.44
42 0.44
43 0.41
44 0.43
45 0.44
46 0.45
47 0.5