Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4BH85

Protein Details
Accession A0A1G4BH85    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
8-30IFFILKKNKKKLRFIINYKKLNEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences SSLIRVLIFFILKKNKKKLRFIINYKKLNEITKKNYYLLPFIIKLKKILYKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.65
4 0.73
5 0.75
6 0.76
7 0.78
8 0.81
9 0.82
10 0.83
11 0.82
12 0.74
13 0.7
14 0.6
15 0.56
16 0.52
17 0.48
18 0.46
19 0.47
20 0.48
21 0.45
22 0.47
23 0.43
24 0.39
25 0.35
26 0.32
27 0.27
28 0.31
29 0.35
30 0.33
31 0.34
32 0.36