Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4AUI5

Protein Details
Accession A0A1G4AUI5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-79TPELRRVATRCKAKKRRNHNLAASHKTHydrophilic
NLS Segment(s)
PositionSequence
67-67K
Subcellular Location(s) nucl 12.5, cyto_nucl 11, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKYATLMSHSLVSPPREGNGEKLLAQCPGGTGDEGNDSVDDDGDGDAYDFESTPELRRVATRCKAKKRRNHNLAASHKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.24
5 0.25
6 0.24
7 0.24
8 0.23
9 0.24
10 0.24
11 0.21
12 0.2
13 0.16
14 0.12
15 0.11
16 0.1
17 0.08
18 0.07
19 0.07
20 0.08
21 0.09
22 0.08
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.08
41 0.11
42 0.12
43 0.12
44 0.16
45 0.2
46 0.28
47 0.36
48 0.44
49 0.51
50 0.62
51 0.72
52 0.78
53 0.84
54 0.86
55 0.89
56 0.89
57 0.89
58 0.87
59 0.87