Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4BG53

Protein Details
Accession A0A1G4BG53    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-50HLEPKWSARRRPRKGRGPRCEVQTBasic
NLS Segment(s)
PositionSequence
32-44WSARRRPRKGRGP
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MPQLKQPTAALSPNATIAQRLRAACPHLEPKWSARRRPRKGRGPRCEVQTAPPDVGLSSSDNCPLAHPSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.17
4 0.15
5 0.18
6 0.2
7 0.2
8 0.2
9 0.22
10 0.24
11 0.23
12 0.26
13 0.29
14 0.25
15 0.27
16 0.27
17 0.3
18 0.38
19 0.42
20 0.45
21 0.49
22 0.59
23 0.66
24 0.76
25 0.8
26 0.8
27 0.86
28 0.9
29 0.89
30 0.87
31 0.82
32 0.77
33 0.72
34 0.62
35 0.56
36 0.52
37 0.45
38 0.37
39 0.32
40 0.27
41 0.21
42 0.21
43 0.17
44 0.13
45 0.12
46 0.13
47 0.15
48 0.16
49 0.16
50 0.17
51 0.19