Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0P1G0

Protein Details
Accession C0P1G0   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-112YLSELRKKKYFIKKKNKLNLLKMHydrophilic
NLS Segment(s)
PositionSequence
96-106KKKYFIKKKNK
Subcellular Location(s) mito 16, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005840  C:ribosome  
Amino Acid Sequences MIRNWKNSIYVYNKKNITLISEINEISINLIKNYFNAYYSKTKNFFRTRLIYKKYLTSKHRIFFSDAQLKHTNDLVNITIYFYDPKIRLYLSELRKKKYFIKKKNKLNLLKMIGKYFILKQRRITKNILLNNFDKCNFKNLKLFTNLYYNLFLNKTFKIAKLYLYILQLIYINKSKFRNNYLQGLVNIIKKLYKKNVQFNFVNIKYYFFNSQIITQRFVLDIQKNRKYLNKSLKKIIKNIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.44
4 0.39
5 0.35
6 0.32
7 0.28
8 0.29
9 0.28
10 0.26
11 0.25
12 0.2
13 0.17
14 0.18
15 0.15
16 0.12
17 0.14
18 0.13
19 0.14
20 0.18
21 0.17
22 0.15
23 0.16
24 0.21
25 0.28
26 0.33
27 0.4
28 0.4
29 0.44
30 0.52
31 0.58
32 0.57
33 0.56
34 0.59
35 0.61
36 0.66
37 0.68
38 0.64
39 0.59
40 0.63
41 0.63
42 0.63
43 0.6
44 0.6
45 0.62
46 0.61
47 0.63
48 0.57
49 0.55
50 0.5
51 0.54
52 0.53
53 0.46
54 0.47
55 0.48
56 0.46
57 0.41
58 0.39
59 0.31
60 0.22
61 0.24
62 0.18
63 0.14
64 0.13
65 0.13
66 0.1
67 0.1
68 0.1
69 0.09
70 0.12
71 0.11
72 0.12
73 0.13
74 0.13
75 0.13
76 0.17
77 0.26
78 0.29
79 0.38
80 0.41
81 0.44
82 0.47
83 0.49
84 0.53
85 0.55
86 0.58
87 0.6
88 0.68
89 0.73
90 0.81
91 0.88
92 0.88
93 0.84
94 0.79
95 0.77
96 0.71
97 0.67
98 0.58
99 0.5
100 0.41
101 0.34
102 0.29
103 0.23
104 0.25
105 0.24
106 0.25
107 0.3
108 0.4
109 0.45
110 0.48
111 0.48
112 0.47
113 0.5
114 0.53
115 0.5
116 0.44
117 0.4
118 0.39
119 0.37
120 0.32
121 0.27
122 0.22
123 0.26
124 0.25
125 0.26
126 0.29
127 0.3
128 0.33
129 0.35
130 0.36
131 0.29
132 0.33
133 0.31
134 0.27
135 0.27
136 0.23
137 0.2
138 0.19
139 0.18
140 0.15
141 0.14
142 0.16
143 0.15
144 0.16
145 0.19
146 0.19
147 0.21
148 0.21
149 0.23
150 0.22
151 0.22
152 0.22
153 0.17
154 0.16
155 0.16
156 0.13
157 0.14
158 0.17
159 0.17
160 0.21
161 0.24
162 0.29
163 0.31
164 0.37
165 0.44
166 0.43
167 0.49
168 0.48
169 0.49
170 0.44
171 0.44
172 0.4
173 0.34
174 0.3
175 0.23
176 0.23
177 0.22
178 0.28
179 0.33
180 0.38
181 0.43
182 0.53
183 0.6
184 0.64
185 0.62
186 0.61
187 0.63
188 0.55
189 0.52
190 0.42
191 0.38
192 0.33
193 0.35
194 0.33
195 0.24
196 0.26
197 0.22
198 0.28
199 0.34
200 0.35
201 0.35
202 0.33
203 0.32
204 0.3
205 0.3
206 0.32
207 0.3
208 0.37
209 0.43
210 0.5
211 0.51
212 0.54
213 0.6
214 0.6
215 0.62
216 0.64
217 0.65
218 0.65
219 0.73
220 0.79
221 0.78