Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AXK2

Protein Details
Accession A0A1G4AXK2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25LIFFIFKKNKKKLKLIIDYKKLNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences RVLIFFIFKKNKKKLKLIIDYKKLNEIIKKNYYLLPLIVKLKKILYRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.8
4 0.81
5 0.8
6 0.8
7 0.77
8 0.69
9 0.64
10 0.55
11 0.46
12 0.41
13 0.36
14 0.35
15 0.36
16 0.37
17 0.34
18 0.35
19 0.35
20 0.3
21 0.27
22 0.23
23 0.22
24 0.28
25 0.29
26 0.28
27 0.28
28 0.33