Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B0D4

Protein Details
Accession A0A1G4B0D4    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-25IFFVLKKNKKKLKLIINYKRLNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences KVLIFFVLKKNKKKLKLIINYKRLNEIIKKNYYLLPLITELKEILYKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.79
4 0.82
5 0.82
6 0.83
7 0.8
8 0.72
9 0.66
10 0.56
11 0.49
12 0.43
13 0.41
14 0.39
15 0.38
16 0.38
17 0.37
18 0.38
19 0.37
20 0.32
21 0.25
22 0.2
23 0.19
24 0.21
25 0.2
26 0.18
27 0.17
28 0.17