Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B8Y2

Protein Details
Accession A0A1G4B8Y2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-86ELLRNSKDKRARKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
68-90SKDKRARKLAKKRLGTFGRAKRK
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKEAPVKTGLATGLNHGHKTTARVVKPRVSRTKGHLSKRTAFVRDVVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRAKRKVEEMTRVIAESRRVGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.23
5 0.24
6 0.23
7 0.26
8 0.31
9 0.32
10 0.34
11 0.4
12 0.44
13 0.5
14 0.56
15 0.62
16 0.63
17 0.6
18 0.59
19 0.59
20 0.66
21 0.66
22 0.68
23 0.66
24 0.62
25 0.64
26 0.67
27 0.65
28 0.56
29 0.49
30 0.44
31 0.42
32 0.37
33 0.33
34 0.26
35 0.21
36 0.19
37 0.18
38 0.15
39 0.09
40 0.08
41 0.06
42 0.07
43 0.08
44 0.11
45 0.1
46 0.1
47 0.11
48 0.12
49 0.16
50 0.22
51 0.28
52 0.3
53 0.36
54 0.36
55 0.43
56 0.5
57 0.52
58 0.53
59 0.58
60 0.64
61 0.69
62 0.79
63 0.83
64 0.84
65 0.86
66 0.82
67 0.81
68 0.76
69 0.72
70 0.71
71 0.7
72 0.71
73 0.68
74 0.66
75 0.59
76 0.61
77 0.62
78 0.58
79 0.57
80 0.49
81 0.49
82 0.48
83 0.45
84 0.41
85 0.37
86 0.34