Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AUG6

Protein Details
Accession A0A1G4AUG6    Localization Confidence High Confidence Score 22.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-213QDDERERERERDRRRREERDREREDLARAADRKERERQDRERQERKABasic
228-249EKDERRQERKRLEKAEKEREKDBasic
276-296KSDKKKSSSTKEKEKDKRSRSBasic
386-406EDSSRRSKSRRSSETKTRDKSHydrophilic
509-529EEDRHYQRSHRHRTQSPEAMSHydrophilic
NLS Segment(s)
PositionSequence
170-263ERERERERDRRRREERDREREDLARAADRKERERQDRERQERKAYEKAAKRAVEKAAAEKDERRQERKRLEKAEKEREKDRKRDAEEKLRRHKP
278-298DKKKSSSTKEKEKDKRSRSIP
391-410RSKSRRSSETKTRDKSSHKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MSALPPDPYKILGVSKDAQVTDIRSAYRKLVLKCHPDKVQDPTLKAQKQDEFQKVQQAYEILSDENERGKYDDNVRLAELRKEIGKGMSANTSAPRAPAARSYEVRTAEPRSDTYKTTYRGSPGGKPMYSTGYNSRSWDEEIHSRSNSIFDEPRARRAASYEKPSRQDDERERERERDRRRREERDREREDLARAADRKERERQDRERQERKAYEKAAKRAVEKAAAEKDERRQERKRLEKAEKEREKDRKRDAEEKLRRHKPAYIEEDESTYFAKSDKKKSSSTKEKEKDKRSRSIPRDGVPLREEPPAPPMPPVPADAKASKYNDTMLYAASYMDQSRKAVHPGLSRAQTAYEVRYSPPAAVPTPPAAAPFPPPPPPPMPTVEEDSSRRSKSRRSSETKTRDKSSHKKSSPTKEAPVPVPPSPNVVDASPSTRHMAQFASATSSPTSTSPPKHLGRSATFNDGYNRPPPGPVRAQTFSHVPAESADTRGRGRSRLQPQILSEDSDSEEDRHYQRSHRHRTQSPEAMSHEIGQRTRYMVNAGRTVPVAAEAAYPAMYRGDSPPRKHSKPTTYYDVRPSMPSREGSYSSSSPFFPKVKTARYDTVQYSDIPHRSRNEYTQAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.32
4 0.31
5 0.3
6 0.28
7 0.28
8 0.28
9 0.28
10 0.26
11 0.26
12 0.28
13 0.29
14 0.34
15 0.38
16 0.37
17 0.43
18 0.5
19 0.57
20 0.62
21 0.67
22 0.66
23 0.66
24 0.67
25 0.65
26 0.66
27 0.62
28 0.59
29 0.6
30 0.63
31 0.61
32 0.59
33 0.58
34 0.54
35 0.55
36 0.6
37 0.6
38 0.57
39 0.56
40 0.62
41 0.56
42 0.51
43 0.46
44 0.38
45 0.3
46 0.26
47 0.25
48 0.16
49 0.16
50 0.17
51 0.16
52 0.19
53 0.19
54 0.17
55 0.17
56 0.2
57 0.24
58 0.3
59 0.35
60 0.33
61 0.34
62 0.35
63 0.38
64 0.37
65 0.36
66 0.31
67 0.27
68 0.26
69 0.25
70 0.25
71 0.22
72 0.23
73 0.2
74 0.21
75 0.23
76 0.21
77 0.22
78 0.22
79 0.23
80 0.2
81 0.19
82 0.2
83 0.17
84 0.18
85 0.22
86 0.27
87 0.3
88 0.33
89 0.37
90 0.41
91 0.42
92 0.43
93 0.4
94 0.39
95 0.36
96 0.36
97 0.34
98 0.33
99 0.34
100 0.33
101 0.36
102 0.39
103 0.38
104 0.4
105 0.4
106 0.37
107 0.41
108 0.43
109 0.43
110 0.44
111 0.47
112 0.43
113 0.41
114 0.4
115 0.39
116 0.37
117 0.34
118 0.33
119 0.3
120 0.32
121 0.33
122 0.33
123 0.29
124 0.29
125 0.28
126 0.25
127 0.28
128 0.31
129 0.34
130 0.32
131 0.31
132 0.29
133 0.29
134 0.26
135 0.23
136 0.21
137 0.19
138 0.29
139 0.3
140 0.37
141 0.38
142 0.37
143 0.33
144 0.35
145 0.42
146 0.38
147 0.46
148 0.49
149 0.52
150 0.56
151 0.58
152 0.58
153 0.53
154 0.55
155 0.55
156 0.56
157 0.58
158 0.6
159 0.6
160 0.63
161 0.67
162 0.67
163 0.69
164 0.7
165 0.7
166 0.75
167 0.81
168 0.85
169 0.88
170 0.9
171 0.9
172 0.9
173 0.87
174 0.8
175 0.75
176 0.67
177 0.58
178 0.51
179 0.41
180 0.36
181 0.31
182 0.3
183 0.31
184 0.31
185 0.34
186 0.39
187 0.45
188 0.49
189 0.56
190 0.63
191 0.69
192 0.76
193 0.82
194 0.82
195 0.79
196 0.79
197 0.76
198 0.73
199 0.7
200 0.64
201 0.62
202 0.6
203 0.61
204 0.6
205 0.56
206 0.52
207 0.49
208 0.46
209 0.42
210 0.36
211 0.35
212 0.32
213 0.31
214 0.31
215 0.29
216 0.33
217 0.38
218 0.42
219 0.44
220 0.46
221 0.52
222 0.61
223 0.68
224 0.7
225 0.7
226 0.74
227 0.77
228 0.8
229 0.83
230 0.8
231 0.75
232 0.75
233 0.76
234 0.74
235 0.73
236 0.72
237 0.7
238 0.68
239 0.73
240 0.71
241 0.72
242 0.73
243 0.75
244 0.76
245 0.75
246 0.71
247 0.64
248 0.61
249 0.56
250 0.55
251 0.53
252 0.46
253 0.43
254 0.4
255 0.4
256 0.36
257 0.31
258 0.22
259 0.15
260 0.11
261 0.09
262 0.15
263 0.18
264 0.27
265 0.34
266 0.37
267 0.44
268 0.51
269 0.6
270 0.65
271 0.67
272 0.7
273 0.7
274 0.76
275 0.79
276 0.82
277 0.82
278 0.77
279 0.78
280 0.75
281 0.78
282 0.73
283 0.73
284 0.68
285 0.6
286 0.63
287 0.55
288 0.5
289 0.42
290 0.38
291 0.3
292 0.28
293 0.26
294 0.18
295 0.22
296 0.21
297 0.19
298 0.18
299 0.16
300 0.15
301 0.16
302 0.17
303 0.14
304 0.14
305 0.17
306 0.17
307 0.19
308 0.22
309 0.23
310 0.23
311 0.21
312 0.21
313 0.19
314 0.19
315 0.16
316 0.12
317 0.11
318 0.09
319 0.09
320 0.07
321 0.07
322 0.06
323 0.07
324 0.08
325 0.08
326 0.1
327 0.11
328 0.13
329 0.16
330 0.19
331 0.21
332 0.24
333 0.29
334 0.29
335 0.28
336 0.26
337 0.23
338 0.22
339 0.19
340 0.17
341 0.14
342 0.13
343 0.13
344 0.16
345 0.15
346 0.14
347 0.14
348 0.14
349 0.13
350 0.13
351 0.15
352 0.13
353 0.14
354 0.13
355 0.13
356 0.12
357 0.11
358 0.14
359 0.15
360 0.17
361 0.2
362 0.21
363 0.24
364 0.26
365 0.28
366 0.28
367 0.28
368 0.28
369 0.26
370 0.31
371 0.29
372 0.29
373 0.29
374 0.31
375 0.33
376 0.31
377 0.32
378 0.28
379 0.34
380 0.4
381 0.49
382 0.54
383 0.57
384 0.64
385 0.72
386 0.8
387 0.83
388 0.79
389 0.74
390 0.7
391 0.71
392 0.73
393 0.72
394 0.73
395 0.66
396 0.7
397 0.74
398 0.77
399 0.78
400 0.74
401 0.69
402 0.64
403 0.64
404 0.57
405 0.55
406 0.49
407 0.41
408 0.39
409 0.34
410 0.32
411 0.29
412 0.28
413 0.23
414 0.18
415 0.18
416 0.16
417 0.2
418 0.18
419 0.18
420 0.18
421 0.19
422 0.19
423 0.18
424 0.18
425 0.15
426 0.15
427 0.14
428 0.17
429 0.15
430 0.17
431 0.16
432 0.16
433 0.15
434 0.14
435 0.19
436 0.18
437 0.21
438 0.25
439 0.32
440 0.36
441 0.39
442 0.42
443 0.43
444 0.43
445 0.47
446 0.45
447 0.44
448 0.41
449 0.39
450 0.39
451 0.35
452 0.34
453 0.3
454 0.3
455 0.24
456 0.27
457 0.27
458 0.3
459 0.34
460 0.35
461 0.39
462 0.4
463 0.41
464 0.4
465 0.41
466 0.37
467 0.33
468 0.29
469 0.22
470 0.2
471 0.23
472 0.21
473 0.21
474 0.2
475 0.19
476 0.2
477 0.25
478 0.26
479 0.25
480 0.28
481 0.35
482 0.42
483 0.5
484 0.53
485 0.52
486 0.52
487 0.56
488 0.52
489 0.45
490 0.37
491 0.29
492 0.26
493 0.24
494 0.23
495 0.17
496 0.17
497 0.18
498 0.2
499 0.24
500 0.24
501 0.29
502 0.37
503 0.47
504 0.56
505 0.62
506 0.69
507 0.7
508 0.77
509 0.81
510 0.81
511 0.74
512 0.68
513 0.62
514 0.58
515 0.52
516 0.46
517 0.41
518 0.36
519 0.33
520 0.29
521 0.27
522 0.25
523 0.25
524 0.23
525 0.23
526 0.25
527 0.29
528 0.33
529 0.32
530 0.31
531 0.31
532 0.3
533 0.24
534 0.2
535 0.15
536 0.1
537 0.1
538 0.09
539 0.09
540 0.09
541 0.09
542 0.08
543 0.08
544 0.08
545 0.09
546 0.14
547 0.24
548 0.31
549 0.37
550 0.47
551 0.56
552 0.6
553 0.68
554 0.72
555 0.72
556 0.73
557 0.75
558 0.75
559 0.73
560 0.74
561 0.74
562 0.69
563 0.6
564 0.58
565 0.54
566 0.5
567 0.47
568 0.44
569 0.41
570 0.4
571 0.41
572 0.39
573 0.42
574 0.39
575 0.38
576 0.37
577 0.33
578 0.31
579 0.34
580 0.34
581 0.29
582 0.36
583 0.4
584 0.46
585 0.51
586 0.55
587 0.57
588 0.58
589 0.63
590 0.57
591 0.55
592 0.48
593 0.43
594 0.41
595 0.42
596 0.44
597 0.4
598 0.42
599 0.43
600 0.48
601 0.53
602 0.54