Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NJ78

Protein Details
Accession C0NJ78    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
84-104REEVLKASGRRERRRKKSKDRBasic
NLS Segment(s)
PositionSequence
90-104ASGRRERRRKKSKDR
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAACKWALAYRQVQYNTASIDRRSDELGKGKLLHRAKTHISGIYMHLKGRLEQWGPRRAIQPTHFFSVEGKRGSVDLELCSSSREEVLKASGRRERRRKKSKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.32
4 0.31
5 0.3
6 0.23
7 0.26
8 0.26
9 0.25
10 0.26
11 0.25
12 0.25
13 0.29
14 0.31
15 0.29
16 0.3
17 0.3
18 0.35
19 0.36
20 0.36
21 0.32
22 0.35
23 0.36
24 0.38
25 0.39
26 0.32
27 0.29
28 0.25
29 0.26
30 0.27
31 0.25
32 0.2
33 0.2
34 0.19
35 0.18
36 0.19
37 0.2
38 0.15
39 0.19
40 0.25
41 0.3
42 0.31
43 0.33
44 0.34
45 0.31
46 0.36
47 0.36
48 0.37
49 0.33
50 0.36
51 0.34
52 0.31
53 0.32
54 0.33
55 0.33
56 0.27
57 0.23
58 0.2
59 0.2
60 0.2
61 0.2
62 0.15
63 0.11
64 0.12
65 0.12
66 0.12
67 0.13
68 0.13
69 0.12
70 0.13
71 0.12
72 0.11
73 0.12
74 0.17
75 0.23
76 0.25
77 0.31
78 0.36
79 0.45
80 0.55
81 0.65
82 0.71
83 0.75
84 0.84