Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AYR5

Protein Details
Accession A0A1G4AYR5   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-130RKSRAICETKRLRKTKRKRLTRAANLQSRWHydrophilic
NLS Segment(s)
PositionSequence
110-120KRLRKTKRKRL
Subcellular Location(s) extr 11, nucl 10, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MLGSLSLLVALDGPVQASASTSTSPNPIFAAAGCAAAHRPTYTLFCFGPGLWFPKDIIVTSKGARLWYMRTRSKLWTKSRRPCGPPGRIVGCLSCSRATARKSRAICETKRLRKTKRKRLTRAANLQSRWQNGTIQTCRTQSGEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.08
6 0.09
7 0.1
8 0.1
9 0.12
10 0.15
11 0.16
12 0.16
13 0.15
14 0.14
15 0.13
16 0.12
17 0.15
18 0.12
19 0.12
20 0.11
21 0.11
22 0.11
23 0.12
24 0.12
25 0.08
26 0.09
27 0.1
28 0.13
29 0.14
30 0.17
31 0.16
32 0.17
33 0.17
34 0.16
35 0.17
36 0.15
37 0.18
38 0.15
39 0.16
40 0.15
41 0.16
42 0.16
43 0.14
44 0.15
45 0.13
46 0.14
47 0.14
48 0.17
49 0.15
50 0.15
51 0.15
52 0.14
53 0.17
54 0.21
55 0.28
56 0.3
57 0.32
58 0.35
59 0.4
60 0.47
61 0.51
62 0.54
63 0.58
64 0.64
65 0.7
66 0.77
67 0.79
68 0.75
69 0.76
70 0.76
71 0.72
72 0.66
73 0.62
74 0.55
75 0.49
76 0.46
77 0.37
78 0.3
79 0.25
80 0.23
81 0.18
82 0.16
83 0.16
84 0.21
85 0.24
86 0.29
87 0.33
88 0.38
89 0.39
90 0.42
91 0.49
92 0.51
93 0.5
94 0.52
95 0.57
96 0.6
97 0.68
98 0.73
99 0.74
100 0.78
101 0.87
102 0.88
103 0.88
104 0.89
105 0.89
106 0.92
107 0.93
108 0.92
109 0.92
110 0.9
111 0.88
112 0.79
113 0.78
114 0.73
115 0.65
116 0.58
117 0.48
118 0.42
119 0.39
120 0.46
121 0.42
122 0.41
123 0.43
124 0.41
125 0.42
126 0.41