Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4BA21

Protein Details
Accession A0A1G4BA21    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
94-118TFAGVKRRLKDKLKKSKKRLEAALEHydrophilic
NLS Segment(s)
PositionSequence
99-112KRRLKDKLKKSKKR
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036869  J_dom_sf  
Amino Acid Sequences MRHQNILKTHSTAEWEFMIRADSMMHMEDRKGLGTEAQTITAAYEVLGDPYQRAQYDKSKQAMVKAMVKAKELRSRKLSEWESKPEELVPPEATFAGVKRRLKDKLKKSKKRLEAALETSAHKAQEAEARLSRASLTRLWNQVRLPRRVSPSKDRSRHAETTLMVGRDGFQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.21
4 0.2
5 0.2
6 0.14
7 0.14
8 0.11
9 0.1
10 0.1
11 0.11
12 0.12
13 0.11
14 0.12
15 0.14
16 0.15
17 0.15
18 0.14
19 0.13
20 0.14
21 0.14
22 0.19
23 0.17
24 0.17
25 0.16
26 0.15
27 0.15
28 0.13
29 0.11
30 0.06
31 0.06
32 0.05
33 0.07
34 0.07
35 0.07
36 0.07
37 0.09
38 0.11
39 0.11
40 0.12
41 0.14
42 0.23
43 0.3
44 0.36
45 0.37
46 0.39
47 0.39
48 0.41
49 0.43
50 0.38
51 0.37
52 0.34
53 0.36
54 0.33
55 0.33
56 0.33
57 0.32
58 0.38
59 0.35
60 0.36
61 0.37
62 0.4
63 0.4
64 0.46
65 0.46
66 0.45
67 0.46
68 0.48
69 0.47
70 0.43
71 0.41
72 0.33
73 0.3
74 0.23
75 0.2
76 0.15
77 0.11
78 0.11
79 0.11
80 0.1
81 0.09
82 0.09
83 0.14
84 0.18
85 0.2
86 0.23
87 0.28
88 0.35
89 0.44
90 0.53
91 0.57
92 0.63
93 0.72
94 0.8
95 0.85
96 0.87
97 0.87
98 0.85
99 0.8
100 0.76
101 0.72
102 0.66
103 0.62
104 0.53
105 0.46
106 0.41
107 0.35
108 0.27
109 0.2
110 0.16
111 0.12
112 0.16
113 0.18
114 0.2
115 0.21
116 0.23
117 0.23
118 0.23
119 0.22
120 0.19
121 0.18
122 0.18
123 0.21
124 0.25
125 0.33
126 0.36
127 0.39
128 0.41
129 0.46
130 0.5
131 0.51
132 0.5
133 0.49
134 0.55
135 0.6
136 0.63
137 0.66
138 0.69
139 0.74
140 0.76
141 0.74
142 0.74
143 0.73
144 0.71
145 0.64
146 0.59
147 0.49
148 0.49
149 0.5
150 0.43
151 0.34
152 0.29