Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AW50

Protein Details
Accession A0A1G4AW50   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKSSSKPQGPKKREVLPSKBasic
NLS Segment(s)
PositionSequence
4-15RKSSSKPQGPKK
Subcellular Location(s) cyto 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKKREVLPSKFTCLFCNHEDSVAVKLDKKAGVGSLDCRVCGQMFQCSINYLSAAVDVYGEWVDAADAVAKEAGPVGGSHNKTSSVRRAPPSRPVDDDDGDRRYGGEGIDVDDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.81
4 0.8
5 0.77
6 0.75
7 0.73
8 0.71
9 0.69
10 0.61
11 0.54
12 0.48
13 0.45
14 0.38
15 0.39
16 0.32
17 0.27
18 0.27
19 0.25
20 0.24
21 0.22
22 0.2
23 0.16
24 0.16
25 0.19
26 0.18
27 0.18
28 0.15
29 0.13
30 0.14
31 0.13
32 0.15
33 0.18
34 0.17
35 0.17
36 0.17
37 0.16
38 0.14
39 0.14
40 0.13
41 0.11
42 0.12
43 0.13
44 0.13
45 0.14
46 0.14
47 0.14
48 0.13
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.04
55 0.03
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.04
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.08
75 0.15
76 0.16
77 0.17
78 0.18
79 0.21
80 0.23
81 0.27
82 0.32
83 0.34
84 0.39
85 0.46
86 0.52
87 0.53
88 0.62
89 0.64
90 0.6
91 0.56
92 0.54
93 0.52
94 0.48
95 0.49
96 0.44
97 0.4
98 0.36
99 0.32
100 0.28
101 0.24
102 0.22
103 0.16
104 0.15
105 0.12
106 0.14
107 0.16