Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B805

Protein Details
Accession A0A1G4B805    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-65PSSSSSSSPTRRRRQQPAPGVADKKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 9, plas 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MATSLLAQCSNTLWCHLRSLPLWAFVLVVLLFGALRQRILPSSSSSSSPTRRRRQQPAPGVADKKTSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.22
4 0.24
5 0.23
6 0.29
7 0.26
8 0.26
9 0.25
10 0.21
11 0.2
12 0.16
13 0.17
14 0.09
15 0.08
16 0.05
17 0.04
18 0.04
19 0.04
20 0.05
21 0.04
22 0.04
23 0.04
24 0.05
25 0.06
26 0.08
27 0.09
28 0.12
29 0.17
30 0.18
31 0.19
32 0.22
33 0.26
34 0.33
35 0.42
36 0.48
37 0.53
38 0.62
39 0.7
40 0.77
41 0.82
42 0.85
43 0.86
44 0.85
45 0.83
46 0.81
47 0.76
48 0.67
49 0.62