Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4B9J6

Protein Details
Accession A0A1G4B9J6   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24LIFFVFKKNKKKLKFIINYKKFNEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences LIFFVFKKNKKKLKFIINYKKFNEIIKKNYYLLPFIIKLKEILYGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.83
4 0.83
5 0.84
6 0.76
7 0.73
8 0.63
9 0.57
10 0.54
11 0.48
12 0.45
13 0.43
14 0.44
15 0.4
16 0.42
17 0.4
18 0.33
19 0.29
20 0.27
21 0.24
22 0.24
23 0.24
24 0.21
25 0.21
26 0.2