Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AZT1

Protein Details
Accession A0A1G4AZT1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MIRSNRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
74-89NRKKAAKAKAAAKKKA
Subcellular Location(s) plas 18, E.R. 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MSGTLVGFAMLVAASVIFTYYSIWTLLMPFVDEGHPLQSFFPARVWAIRIPVILILLGSAVVGSFLGTVMIRSNRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.05
7 0.05
8 0.06
9 0.07
10 0.07
11 0.07
12 0.08
13 0.08
14 0.07
15 0.07
16 0.06
17 0.07
18 0.07
19 0.08
20 0.08
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.11
27 0.11
28 0.11
29 0.1
30 0.1
31 0.1
32 0.12
33 0.11
34 0.12
35 0.12
36 0.12
37 0.11
38 0.1
39 0.1
40 0.07
41 0.06
42 0.04
43 0.03
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.04
56 0.07
57 0.13
58 0.19
59 0.23
60 0.29
61 0.37
62 0.42
63 0.49
64 0.55
65 0.6
66 0.64
67 0.69
68 0.73
69 0.75