Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B5A8

Protein Details
Accession A0A1G4B5A8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-113YYYRVSLKKIGRRRRRRRRHHSHKSDSSRSSKBasic
NLS Segment(s)
PositionSequence
89-107KKIGRRRRRRRRHHSHKSD
Subcellular Location(s) nucl 10.5, cyto_nucl 7.5, mito 5, cyto 3.5, plas 3, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYIPQPSQGRAPRSFRLGTEPRSVAPSWPRSLEVAARTDKADNTIARRQVSISGGQTTNLTVGITVGVAILIFILGVGAFLYYYRVSLKKIGRRRRRRRRHHSHKSDSSRSSKSSADDGPASHPPPPAPPPAPRSAAPSAAPADPPADAPVDAPAPADPPADPPAETPAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.47
3 0.5
4 0.5
5 0.47
6 0.49
7 0.46
8 0.41
9 0.43
10 0.42
11 0.37
12 0.38
13 0.39
14 0.35
15 0.35
16 0.35
17 0.33
18 0.34
19 0.34
20 0.29
21 0.28
22 0.27
23 0.26
24 0.26
25 0.26
26 0.24
27 0.23
28 0.24
29 0.21
30 0.25
31 0.3
32 0.33
33 0.32
34 0.32
35 0.3
36 0.29
37 0.28
38 0.25
39 0.21
40 0.21
41 0.2
42 0.2
43 0.19
44 0.16
45 0.15
46 0.11
47 0.09
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.01
61 0.01
62 0.01
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.04
70 0.04
71 0.06
72 0.07
73 0.08
74 0.14
75 0.2
76 0.27
77 0.36
78 0.47
79 0.56
80 0.67
81 0.78
82 0.83
83 0.88
84 0.92
85 0.94
86 0.95
87 0.96
88 0.96
89 0.95
90 0.94
91 0.94
92 0.91
93 0.88
94 0.82
95 0.77
96 0.69
97 0.6
98 0.53
99 0.44
100 0.37
101 0.33
102 0.28
103 0.25
104 0.22
105 0.21
106 0.22
107 0.24
108 0.24
109 0.22
110 0.22
111 0.19
112 0.23
113 0.25
114 0.28
115 0.28
116 0.32
117 0.36
118 0.4
119 0.43
120 0.4
121 0.43
122 0.4
123 0.39
124 0.34
125 0.32
126 0.29
127 0.26
128 0.26
129 0.2
130 0.18
131 0.15
132 0.14
133 0.12
134 0.11
135 0.1
136 0.1
137 0.12
138 0.12
139 0.11
140 0.11
141 0.1
142 0.11
143 0.12
144 0.12
145 0.1
146 0.13
147 0.17
148 0.17
149 0.17
150 0.17
151 0.22