Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4BT73

Protein Details
Accession A0A1G4BT73   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-39FYYNIKTKRLNNKLNYKKLKPFKINKKVLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences LKKRDNIYFFYYNIKTKRLNNKLNYKKLKPFKINKKVLLINFKLKLLNII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.42
4 0.52
5 0.54
6 0.6
7 0.61
8 0.7
9 0.76
10 0.81
11 0.81
12 0.75
13 0.74
14 0.74
15 0.74
16 0.73
17 0.74
18 0.75
19 0.78
20 0.81
21 0.77
22 0.76
23 0.73
24 0.7
25 0.69
26 0.62
27 0.6
28 0.54
29 0.51
30 0.45