Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4BPM6

Protein Details
Accession A0A1G4BPM6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-95RTRGHIRRLVPRKRNPANHLBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto_mito 13.333, mito_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MMDRGASRKLALLQLVTCSLSALLEWPPSGESKSSQAGLPPCFPLPSTISLVSKLLEATKSVTMMDKCPCQVVTARTRGHIRRLVPRKRNPANHLIGMIYGKDGRRYPMKKLRLDVIVKYCKLETKLAAAQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.17
5 0.14
6 0.12
7 0.1
8 0.09
9 0.08
10 0.08
11 0.08
12 0.09
13 0.09
14 0.1
15 0.11
16 0.12
17 0.12
18 0.12
19 0.15
20 0.17
21 0.18
22 0.17
23 0.2
24 0.23
25 0.24
26 0.24
27 0.23
28 0.21
29 0.2
30 0.2
31 0.19
32 0.17
33 0.17
34 0.19
35 0.19
36 0.19
37 0.19
38 0.19
39 0.17
40 0.15
41 0.12
42 0.09
43 0.08
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.11
50 0.11
51 0.13
52 0.15
53 0.14
54 0.14
55 0.14
56 0.14
57 0.13
58 0.15
59 0.18
60 0.22
61 0.28
62 0.28
63 0.3
64 0.36
65 0.36
66 0.4
67 0.4
68 0.37
69 0.4
70 0.5
71 0.57
72 0.62
73 0.69
74 0.73
75 0.77
76 0.82
77 0.77
78 0.76
79 0.71
80 0.63
81 0.55
82 0.45
83 0.37
84 0.29
85 0.24
86 0.16
87 0.13
88 0.12
89 0.14
90 0.15
91 0.18
92 0.28
93 0.3
94 0.39
95 0.47
96 0.55
97 0.57
98 0.6
99 0.62
100 0.6
101 0.62
102 0.59
103 0.58
104 0.58
105 0.53
106 0.51
107 0.46
108 0.43
109 0.42
110 0.4
111 0.32
112 0.31