Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4BF34

Protein Details
Accession A0A1G4BF34    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-41AANAACRDKKKRDDAHHSRRSLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MKCKSPYFGFAACLQTSVAANAACRDKKKRDDAHHSRRSLQACRRIFALSSLAPSVDAGSVCLRRAPQAPASNLAVSNPKAWCTKLIMGIRMPSLPSSPCHCLRCSRPAVTASALTLEYRSTQRPTAHASESSSPVDVISCNQPPGTRPIAVPEATKGGITSEAARGKTRTPNPSTLSNPSRHPGIRQPIREFPLCLALLPTSSFLSRFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.19
4 0.17
5 0.15
6 0.11
7 0.11
8 0.14
9 0.21
10 0.24
11 0.29
12 0.36
13 0.42
14 0.5
15 0.6
16 0.66
17 0.7
18 0.77
19 0.83
20 0.87
21 0.87
22 0.82
23 0.76
24 0.72
25 0.68
26 0.65
27 0.63
28 0.61
29 0.55
30 0.53
31 0.51
32 0.45
33 0.4
34 0.33
35 0.29
36 0.2
37 0.19
38 0.18
39 0.17
40 0.15
41 0.15
42 0.13
43 0.09
44 0.08
45 0.07
46 0.1
47 0.11
48 0.11
49 0.13
50 0.12
51 0.14
52 0.17
53 0.19
54 0.23
55 0.29
56 0.3
57 0.32
58 0.34
59 0.32
60 0.29
61 0.27
62 0.23
63 0.18
64 0.19
65 0.16
66 0.16
67 0.16
68 0.17
69 0.18
70 0.19
71 0.2
72 0.24
73 0.26
74 0.26
75 0.25
76 0.26
77 0.25
78 0.21
79 0.19
80 0.12
81 0.11
82 0.1
83 0.11
84 0.14
85 0.17
86 0.22
87 0.23
88 0.24
89 0.27
90 0.31
91 0.37
92 0.37
93 0.34
94 0.33
95 0.32
96 0.32
97 0.29
98 0.26
99 0.18
100 0.14
101 0.13
102 0.1
103 0.09
104 0.07
105 0.08
106 0.09
107 0.11
108 0.12
109 0.16
110 0.17
111 0.19
112 0.24
113 0.26
114 0.27
115 0.26
116 0.27
117 0.26
118 0.27
119 0.26
120 0.21
121 0.17
122 0.15
123 0.14
124 0.11
125 0.1
126 0.12
127 0.12
128 0.13
129 0.13
130 0.14
131 0.15
132 0.2
133 0.22
134 0.19
135 0.17
136 0.21
137 0.25
138 0.25
139 0.25
140 0.21
141 0.2
142 0.19
143 0.19
144 0.14
145 0.11
146 0.11
147 0.11
148 0.11
149 0.14
150 0.18
151 0.19
152 0.21
153 0.22
154 0.25
155 0.34
156 0.39
157 0.42
158 0.44
159 0.5
160 0.52
161 0.57
162 0.59
163 0.59
164 0.57
165 0.52
166 0.51
167 0.46
168 0.48
169 0.42
170 0.42
171 0.42
172 0.47
173 0.52
174 0.57
175 0.61
176 0.63
177 0.66
178 0.65
179 0.57
180 0.48
181 0.47
182 0.39
183 0.32
184 0.26
185 0.22
186 0.2
187 0.19
188 0.19
189 0.14
190 0.14