Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AYG8

Protein Details
Accession A0A1G4AYG8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-81QQGGRRGDRRDDRRGGKSRGPKRKHDVGRSAWSRBasic
NLS Segment(s)
PositionSequence
51-82GRRGDRRDDRRGGKSRGPKRKHDVGRSAWSRE
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020097  PsdUridine_synth_TruA_a/b_dom  
IPR020095  PsdUridine_synth_TruA_C  
IPR041708  PUS1/PUS2-like  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0043231  C:intracellular membrane-bounded organelle  
GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0031119  P:tRNA pseudouridine synthesis  
Pfam View protein in Pfam  
PF01416  PseudoU_synth_1  
CDD cd02568  PseudoU_synth_PUS1_PUS2  
Amino Acid Sequences MATDAPPQPAGGAPARQPADLPTGDKPSVSSESRAESAAQPGSAEDKQQGGRRGDRRDDRRGGKSRGPKRKHDVGRSAWSREATDKRGRNSEYQEFKRRKVDKDGNPEAVENPFTAEEIAAEGRKPKRKVAVMVGYSGTGYKGMQINNEEKTIEGDLFKAFVAAGAISKANADDHKKSSLVRCARTDKGVHAAGNVISLKLIIEDEAIVEKINAALPDQIRVWGIQRTNNSFSCYQTCDSRWYEYLLPTYCLLPPHPDSWLWKQLVEAAKEKGYYEEFQKKLADVEGYWRKVDEEDIKPILDKLDPETKAKVMERIHADEDATAQADDAKPAPETKTEETPVEPATEENKTPAEVPEGSVKPKNRDLTPLDFALRDIKAAYIAAKRRYRVTPERLTQLQEALNMYCGTINFHNYTVQKSFKDPSAKRHIKSFKVNMQPIQIRDTEWVSTKVHGQSFMMHQIRKMVGMASLVVRCATPLERIKESYGPTRIAIPKAPGLGLLLERPVFDAYNKRAQDNFGKETIDFTKYDEKLQAFKDKQIYQRIFEVEEQENTFHIFFQQVDNFKSDYFLWLTAGGIEAGGVRTGKEEKGGKTLEAELGDEDEDPVNGDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.31
4 0.3
5 0.29
6 0.31
7 0.29
8 0.3
9 0.27
10 0.32
11 0.32
12 0.32
13 0.3
14 0.29
15 0.33
16 0.32
17 0.3
18 0.27
19 0.31
20 0.32
21 0.32
22 0.29
23 0.25
24 0.28
25 0.27
26 0.24
27 0.19
28 0.19
29 0.23
30 0.22
31 0.21
32 0.17
33 0.2
34 0.25
35 0.31
36 0.38
37 0.38
38 0.47
39 0.52
40 0.59
41 0.64
42 0.7
43 0.72
44 0.74
45 0.78
46 0.77
47 0.8
48 0.81
49 0.78
50 0.76
51 0.79
52 0.79
53 0.81
54 0.8
55 0.8
56 0.79
57 0.83
58 0.83
59 0.83
60 0.82
61 0.79
62 0.83
63 0.79
64 0.74
65 0.67
66 0.59
67 0.51
68 0.5
69 0.48
70 0.45
71 0.49
72 0.5
73 0.52
74 0.59
75 0.6
76 0.59
77 0.6
78 0.63
79 0.64
80 0.66
81 0.71
82 0.68
83 0.7
84 0.73
85 0.71
86 0.67
87 0.68
88 0.7
89 0.69
90 0.74
91 0.77
92 0.73
93 0.68
94 0.63
95 0.54
96 0.45
97 0.37
98 0.26
99 0.2
100 0.14
101 0.13
102 0.12
103 0.1
104 0.08
105 0.09
106 0.1
107 0.09
108 0.09
109 0.16
110 0.23
111 0.32
112 0.34
113 0.37
114 0.44
115 0.49
116 0.55
117 0.58
118 0.6
119 0.54
120 0.54
121 0.49
122 0.41
123 0.35
124 0.29
125 0.2
126 0.1
127 0.09
128 0.09
129 0.12
130 0.13
131 0.16
132 0.2
133 0.24
134 0.26
135 0.27
136 0.24
137 0.2
138 0.22
139 0.2
140 0.16
141 0.13
142 0.11
143 0.11
144 0.11
145 0.11
146 0.08
147 0.07
148 0.06
149 0.06
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.07
158 0.11
159 0.16
160 0.19
161 0.22
162 0.25
163 0.26
164 0.28
165 0.32
166 0.37
167 0.39
168 0.4
169 0.43
170 0.46
171 0.48
172 0.5
173 0.46
174 0.39
175 0.39
176 0.37
177 0.31
178 0.25
179 0.24
180 0.19
181 0.21
182 0.18
183 0.12
184 0.09
185 0.09
186 0.08
187 0.07
188 0.07
189 0.04
190 0.04
191 0.04
192 0.05
193 0.06
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.09
203 0.09
204 0.11
205 0.12
206 0.12
207 0.11
208 0.12
209 0.13
210 0.14
211 0.15
212 0.18
213 0.22
214 0.27
215 0.31
216 0.32
217 0.33
218 0.3
219 0.31
220 0.29
221 0.28
222 0.24
223 0.23
224 0.24
225 0.26
226 0.27
227 0.28
228 0.25
229 0.25
230 0.26
231 0.24
232 0.27
233 0.23
234 0.22
235 0.2
236 0.2
237 0.18
238 0.17
239 0.16
240 0.15
241 0.16
242 0.16
243 0.17
244 0.17
245 0.2
246 0.25
247 0.32
248 0.28
249 0.26
250 0.25
251 0.29
252 0.32
253 0.3
254 0.27
255 0.21
256 0.22
257 0.22
258 0.22
259 0.18
260 0.16
261 0.15
262 0.18
263 0.25
264 0.24
265 0.26
266 0.26
267 0.25
268 0.24
269 0.23
270 0.18
271 0.09
272 0.17
273 0.22
274 0.23
275 0.23
276 0.22
277 0.21
278 0.21
279 0.24
280 0.22
281 0.18
282 0.21
283 0.22
284 0.22
285 0.21
286 0.21
287 0.19
288 0.13
289 0.11
290 0.1
291 0.17
292 0.18
293 0.2
294 0.21
295 0.2
296 0.23
297 0.23
298 0.25
299 0.18
300 0.22
301 0.24
302 0.25
303 0.26
304 0.23
305 0.23
306 0.17
307 0.17
308 0.13
309 0.1
310 0.07
311 0.05
312 0.06
313 0.06
314 0.07
315 0.06
316 0.07
317 0.07
318 0.08
319 0.09
320 0.1
321 0.15
322 0.16
323 0.2
324 0.21
325 0.22
326 0.21
327 0.22
328 0.2
329 0.17
330 0.14
331 0.11
332 0.12
333 0.13
334 0.12
335 0.12
336 0.11
337 0.11
338 0.12
339 0.12
340 0.12
341 0.11
342 0.12
343 0.18
344 0.19
345 0.21
346 0.25
347 0.27
348 0.28
349 0.34
350 0.36
351 0.3
352 0.35
353 0.37
354 0.39
355 0.39
356 0.37
357 0.32
358 0.28
359 0.28
360 0.25
361 0.2
362 0.14
363 0.11
364 0.1
365 0.09
366 0.09
367 0.11
368 0.13
369 0.18
370 0.26
371 0.29
372 0.31
373 0.35
374 0.38
375 0.44
376 0.47
377 0.51
378 0.52
379 0.53
380 0.58
381 0.55
382 0.55
383 0.47
384 0.41
385 0.33
386 0.26
387 0.23
388 0.17
389 0.17
390 0.13
391 0.13
392 0.1
393 0.09
394 0.11
395 0.11
396 0.13
397 0.13
398 0.14
399 0.19
400 0.18
401 0.22
402 0.24
403 0.26
404 0.24
405 0.26
406 0.28
407 0.29
408 0.39
409 0.37
410 0.42
411 0.5
412 0.56
413 0.54
414 0.62
415 0.64
416 0.6
417 0.68
418 0.67
419 0.64
420 0.66
421 0.69
422 0.62
423 0.62
424 0.59
425 0.51
426 0.47
427 0.38
428 0.3
429 0.28
430 0.27
431 0.22
432 0.2
433 0.21
434 0.19
435 0.19
436 0.23
437 0.25
438 0.24
439 0.23
440 0.21
441 0.22
442 0.24
443 0.32
444 0.32
445 0.28
446 0.27
447 0.31
448 0.31
449 0.28
450 0.26
451 0.17
452 0.13
453 0.13
454 0.14
455 0.12
456 0.12
457 0.11
458 0.11
459 0.1
460 0.09
461 0.11
462 0.11
463 0.15
464 0.21
465 0.26
466 0.29
467 0.31
468 0.34
469 0.37
470 0.39
471 0.4
472 0.38
473 0.34
474 0.32
475 0.37
476 0.38
477 0.36
478 0.36
479 0.31
480 0.3
481 0.3
482 0.29
483 0.22
484 0.19
485 0.18
486 0.16
487 0.14
488 0.13
489 0.12
490 0.12
491 0.13
492 0.13
493 0.12
494 0.13
495 0.2
496 0.23
497 0.32
498 0.33
499 0.34
500 0.35
501 0.38
502 0.46
503 0.45
504 0.44
505 0.38
506 0.38
507 0.36
508 0.38
509 0.38
510 0.31
511 0.24
512 0.24
513 0.31
514 0.3
515 0.33
516 0.34
517 0.33
518 0.35
519 0.39
520 0.46
521 0.39
522 0.44
523 0.5
524 0.5
525 0.55
526 0.61
527 0.59
528 0.52
529 0.56
530 0.52
531 0.47
532 0.43
533 0.41
534 0.34
535 0.34
536 0.33
537 0.28
538 0.26
539 0.25
540 0.23
541 0.17
542 0.15
543 0.13
544 0.12
545 0.17
546 0.22
547 0.24
548 0.26
549 0.29
550 0.29
551 0.27
552 0.29
553 0.24
554 0.21
555 0.2
556 0.19
557 0.17
558 0.16
559 0.16
560 0.14
561 0.15
562 0.1
563 0.08
564 0.07
565 0.06
566 0.06
567 0.08
568 0.08
569 0.07
570 0.1
571 0.13
572 0.14
573 0.2
574 0.25
575 0.26
576 0.34
577 0.36
578 0.34
579 0.35
580 0.37
581 0.34
582 0.29
583 0.27
584 0.2
585 0.2
586 0.19
587 0.16
588 0.15
589 0.12
590 0.11