Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NCE0

Protein Details
Accession C0NCE0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MEGSGSERKRKKPEGEHQPPLSTHydrophilic
NLS Segment(s)
PositionSequence
10-11RK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, plas 4, pero 2
Family & Domain DBs
Amino Acid Sequences MEGSGSERKRKKPEGEHQPPLSTGYQEDDIVQLAATRQRPPSSTSSSSTAKKEPGPGNEQHPQAAAAADAAEGRAATRLCCVIPFPFPLPLPFLLVILPPVEAGYGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.86
4 0.8
5 0.74
6 0.64
7 0.57
8 0.48
9 0.37
10 0.28
11 0.21
12 0.19
13 0.17
14 0.16
15 0.13
16 0.12
17 0.11
18 0.1
19 0.07
20 0.07
21 0.11
22 0.12
23 0.14
24 0.16
25 0.17
26 0.19
27 0.23
28 0.27
29 0.3
30 0.32
31 0.32
32 0.34
33 0.37
34 0.39
35 0.37
36 0.34
37 0.29
38 0.27
39 0.31
40 0.3
41 0.3
42 0.31
43 0.31
44 0.34
45 0.37
46 0.37
47 0.3
48 0.27
49 0.23
50 0.19
51 0.17
52 0.11
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.06
62 0.06
63 0.06
64 0.08
65 0.09
66 0.09
67 0.1
68 0.12
69 0.11
70 0.14
71 0.17
72 0.18
73 0.21
74 0.22
75 0.23
76 0.25
77 0.23
78 0.24
79 0.21
80 0.19
81 0.15
82 0.15
83 0.15
84 0.12
85 0.11
86 0.07
87 0.07