Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4AY66

Protein Details
Accession A0A1G4AY66   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28LEWNIPRRHEMQRRKLQRLKWQPPSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 12.333, cyto_nucl 10.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MRLEWNIPRRHEMQRRKLQRLKWQPPSVDKRHIWRLSRPFQISHRHRPKQLRHLAQREGHYWVGGMGSISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.82
4 0.84
5 0.81
6 0.82
7 0.82
8 0.81
9 0.81
10 0.78
11 0.72
12 0.75
13 0.76
14 0.71
15 0.68
16 0.61
17 0.57
18 0.6
19 0.62
20 0.55
21 0.54
22 0.57
23 0.55
24 0.59
25 0.54
26 0.47
27 0.47
28 0.54
29 0.54
30 0.57
31 0.61
32 0.6
33 0.65
34 0.72
35 0.76
36 0.76
37 0.79
38 0.78
39 0.78
40 0.79
41 0.8
42 0.76
43 0.71
44 0.62
45 0.57
46 0.47
47 0.37
48 0.3
49 0.23
50 0.17
51 0.13