Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4BGY1

Protein Details
Accession A0A1G4BGY1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-73AAVAPRSGRPRIKKPRQEASHydrophilic
NLS Segment(s)
PositionSequence
58-69PRSGRPRIKKPR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MARPKGSTTKHLTEAERQRIRTLYNDANLPQAQIVSITGFSKDQVRVAIRAPSAAVAPRSGRPRIKKPRQEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.61
4 0.56
5 0.52
6 0.49
7 0.48
8 0.42
9 0.39
10 0.33
11 0.3
12 0.31
13 0.29
14 0.31
15 0.29
16 0.25
17 0.18
18 0.13
19 0.11
20 0.08
21 0.08
22 0.05
23 0.05
24 0.05
25 0.05
26 0.06
27 0.06
28 0.09
29 0.09
30 0.1
31 0.13
32 0.14
33 0.15
34 0.17
35 0.21
36 0.18
37 0.18
38 0.17
39 0.14
40 0.14
41 0.15
42 0.14
43 0.12
44 0.14
45 0.19
46 0.24
47 0.3
48 0.37
49 0.43
50 0.54
51 0.63
52 0.72
53 0.77