Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NN18

Protein Details
Accession C0NN18    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-129QAGKRGDLRIPKKKHPPNSGLBasic
NLS Segment(s)
PositionSequence
119-122PKKK
Subcellular Location(s) mito 17.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045296  Complex1_LYR_ETFRF1_LYRM5  
Gene Ontology GO:0022904  P:respiratory electron transport chain  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20265  Complex1_LYR_ETFRF1_LYRM5  
Amino Acid Sequences MTAPQLRHQVIRIYKELLFLGREYPLGYQFFRERLHRAFASQAHVTDEAKIADGIRRAEYVKKEIEAFKVWDDKKGRGRGKKCTDIVTPKSQVEEKGQHMVQMKEVGDQAGKRGDLRIPKKKHPPNSGLLLAQFMHHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.37
4 0.3
5 0.25
6 0.2
7 0.19
8 0.16
9 0.15
10 0.14
11 0.14
12 0.15
13 0.16
14 0.16
15 0.18
16 0.19
17 0.23
18 0.25
19 0.27
20 0.29
21 0.29
22 0.35
23 0.32
24 0.31
25 0.32
26 0.31
27 0.33
28 0.29
29 0.27
30 0.23
31 0.24
32 0.23
33 0.19
34 0.18
35 0.12
36 0.12
37 0.11
38 0.09
39 0.1
40 0.12
41 0.12
42 0.12
43 0.13
44 0.13
45 0.17
46 0.19
47 0.2
48 0.19
49 0.19
50 0.2
51 0.2
52 0.22
53 0.2
54 0.19
55 0.17
56 0.23
57 0.23
58 0.27
59 0.28
60 0.3
61 0.36
62 0.43
63 0.49
64 0.5
65 0.55
66 0.59
67 0.65
68 0.68
69 0.63
70 0.58
71 0.57
72 0.57
73 0.58
74 0.55
75 0.5
76 0.42
77 0.42
78 0.39
79 0.35
80 0.32
81 0.32
82 0.28
83 0.31
84 0.3
85 0.31
86 0.34
87 0.32
88 0.28
89 0.27
90 0.25
91 0.2
92 0.21
93 0.18
94 0.16
95 0.16
96 0.16
97 0.16
98 0.16
99 0.15
100 0.17
101 0.2
102 0.28
103 0.37
104 0.45
105 0.49
106 0.58
107 0.68
108 0.76
109 0.82
110 0.82
111 0.79
112 0.76
113 0.76
114 0.71
115 0.62
116 0.54
117 0.46
118 0.36