Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4BNK7

Protein Details
Accession A0A1G4BNK7    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-91PQPKEARCQCRKGEKRKNKGCKVTQTLKKGLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 11.166, mito 9.5, cyto_nucl 8.833, cyto 4
Family & Domain DBs
Amino Acid Sequences MSLSGQVVGGKDSKKPPQALEPYVLAPFAPLPARRPLYPHPDLHLLRLPCKRSKVMPTPPQPKEARCQCRKGEKRKNKGCKVTQTLKKGLCIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.41
4 0.47
5 0.54
6 0.51
7 0.49
8 0.43
9 0.38
10 0.36
11 0.32
12 0.22
13 0.15
14 0.12
15 0.1
16 0.11
17 0.1
18 0.12
19 0.19
20 0.22
21 0.22
22 0.27
23 0.3
24 0.36
25 0.4
26 0.38
27 0.35
28 0.4
29 0.4
30 0.38
31 0.38
32 0.3
33 0.31
34 0.34
35 0.34
36 0.3
37 0.33
38 0.32
39 0.31
40 0.39
41 0.42
42 0.48
43 0.54
44 0.6
45 0.67
46 0.67
47 0.7
48 0.65
49 0.58
50 0.58
51 0.59
52 0.59
53 0.56
54 0.62
55 0.61
56 0.7
57 0.77
58 0.79
59 0.8
60 0.8
61 0.85
62 0.89
63 0.93
64 0.91
65 0.92
66 0.9
67 0.89
68 0.88
69 0.87
70 0.85
71 0.82
72 0.81
73 0.73