Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4B9U6

Protein Details
Accession A0A1G4B9U6   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
184-210AEDGRKKEDAKAKRRRGQEKNEEGHDRBasic
NLS Segment(s)
PositionSequence
187-203GRKKEDAKAKRRRGQEK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012816  NADAR  
IPR037238  YbiA-like_sf  
Pfam View protein in Pfam  
PF08719  NADAR  
CDD cd15457  NADAR  
Amino Acid Sequences MDTTPIYFWRETGPEGYLSQWWTSNPFTQSHSSSSSSSSPSSPSPSPTITFKTAEHYMMHAKALLFSDTDVALSVLKADHPRKVKALGRKVRGFDERAWNENRERIVREGNLLKFRCAPELRRRLLATGERELVEASPMDRIWGIGFAPDKAPWSDRRRWGLNLLGKVLMEVRTVLREEEDKEAEDGRKKEDAKAKRRRGQEKNEEGHDRDEGTVKKSKRVEGDDNSAER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.21
5 0.21
6 0.2
7 0.19
8 0.18
9 0.2
10 0.22
11 0.26
12 0.25
13 0.25
14 0.28
15 0.32
16 0.34
17 0.33
18 0.35
19 0.32
20 0.3
21 0.32
22 0.31
23 0.28
24 0.27
25 0.24
26 0.23
27 0.22
28 0.27
29 0.25
30 0.26
31 0.27
32 0.28
33 0.29
34 0.3
35 0.33
36 0.31
37 0.32
38 0.29
39 0.31
40 0.3
41 0.3
42 0.27
43 0.24
44 0.25
45 0.24
46 0.23
47 0.19
48 0.17
49 0.17
50 0.17
51 0.15
52 0.11
53 0.1
54 0.11
55 0.09
56 0.09
57 0.07
58 0.06
59 0.06
60 0.05
61 0.06
62 0.05
63 0.06
64 0.12
65 0.14
66 0.19
67 0.23
68 0.25
69 0.27
70 0.34
71 0.37
72 0.41
73 0.5
74 0.52
75 0.56
76 0.58
77 0.58
78 0.57
79 0.55
80 0.49
81 0.42
82 0.45
83 0.4
84 0.39
85 0.4
86 0.37
87 0.35
88 0.35
89 0.33
90 0.25
91 0.24
92 0.22
93 0.23
94 0.21
95 0.23
96 0.25
97 0.26
98 0.31
99 0.29
100 0.28
101 0.27
102 0.27
103 0.29
104 0.26
105 0.28
106 0.31
107 0.39
108 0.4
109 0.41
110 0.41
111 0.37
112 0.39
113 0.39
114 0.33
115 0.27
116 0.27
117 0.23
118 0.23
119 0.22
120 0.18
121 0.13
122 0.09
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.08
134 0.08
135 0.09
136 0.1
137 0.11
138 0.12
139 0.14
140 0.2
141 0.26
142 0.33
143 0.4
144 0.46
145 0.48
146 0.5
147 0.51
148 0.51
149 0.51
150 0.46
151 0.4
152 0.34
153 0.3
154 0.28
155 0.25
156 0.18
157 0.12
158 0.1
159 0.09
160 0.11
161 0.11
162 0.11
163 0.12
164 0.13
165 0.15
166 0.19
167 0.2
168 0.19
169 0.2
170 0.23
171 0.25
172 0.29
173 0.28
174 0.27
175 0.32
176 0.32
177 0.38
178 0.44
179 0.51
180 0.55
181 0.65
182 0.71
183 0.73
184 0.81
185 0.85
186 0.86
187 0.87
188 0.87
189 0.87
190 0.83
191 0.83
192 0.8
193 0.71
194 0.64
195 0.55
196 0.46
197 0.36
198 0.36
199 0.3
200 0.28
201 0.34
202 0.33
203 0.39
204 0.42
205 0.46
206 0.48
207 0.54
208 0.59
209 0.58
210 0.66