Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B0J9

Protein Details
Accession A0A1G4B0J9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLPNRPGSKSRKRNRRPSRPPALLAAHydrophilic
NLS Segment(s)
PositionSequence
5-21RPGSKSRKRNRRPSRPP
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MLPNRPGSKSRKRNRRPSRPPALLAAGVQPWKSNLRTGNPPPPPPPRLEYALSVCSSPWPCLGDQSNGPSLGGRDLGWQRHSFFVNGLPQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.93
4 0.93
5 0.93
6 0.89
7 0.81
8 0.75
9 0.67
10 0.56
11 0.46
12 0.37
13 0.29
14 0.23
15 0.21
16 0.16
17 0.14
18 0.16
19 0.16
20 0.18
21 0.19
22 0.22
23 0.3
24 0.36
25 0.43
26 0.44
27 0.47
28 0.48
29 0.51
30 0.48
31 0.42
32 0.39
33 0.33
34 0.32
35 0.31
36 0.29
37 0.26
38 0.27
39 0.24
40 0.22
41 0.19
42 0.19
43 0.18
44 0.16
45 0.14
46 0.13
47 0.13
48 0.17
49 0.2
50 0.2
51 0.21
52 0.24
53 0.25
54 0.24
55 0.24
56 0.2
57 0.18
58 0.16
59 0.15
60 0.11
61 0.14
62 0.19
63 0.23
64 0.26
65 0.28
66 0.29
67 0.33
68 0.34
69 0.29
70 0.26
71 0.28