Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4ATC9

Protein Details
Accession A0A1G4ATC9   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-36QNGMHPRRTTYWKKSHPRRLSKPPVYAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MRCRSFYTQNGMHPRRTTYWKKSHPRRLSKPPVYAATAVRARFSQAPRGSGFRWLMGLLDGSNPDSPEEGWYRCDGGRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.55
4 0.55
5 0.54
6 0.61
7 0.66
8 0.75
9 0.81
10 0.86
11 0.88
12 0.9
13 0.89
14 0.89
15 0.9
16 0.86
17 0.81
18 0.75
19 0.67
20 0.59
21 0.51
22 0.41
23 0.36
24 0.32
25 0.26
26 0.22
27 0.19
28 0.18
29 0.21
30 0.22
31 0.25
32 0.23
33 0.26
34 0.27
35 0.3
36 0.29
37 0.31
38 0.3
39 0.22
40 0.21
41 0.18
42 0.17
43 0.13
44 0.13
45 0.08
46 0.08
47 0.08
48 0.09
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.14
55 0.18
56 0.18
57 0.19
58 0.2
59 0.23