Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4ASK2

Protein Details
Accession A0A1G4ASK2   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-119RKDYVRRHMREKHQDQNNKVRQQRPRRNRLLWKQBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 14, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGSASFRSASRHCHWKDCQFSTSNSETYEEHMLLHRRCPKDGCLSEFKEEKDIQRHVWKTHRRWAFSTKYPSIRGVCGICGKIYERKDYVRRHMREKHQDQNNKVRQQRPRRNRLLWKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.67
4 0.64
5 0.63
6 0.56
7 0.56
8 0.53
9 0.5
10 0.42
11 0.34
12 0.31
13 0.26
14 0.26
15 0.26
16 0.2
17 0.16
18 0.19
19 0.24
20 0.23
21 0.3
22 0.35
23 0.34
24 0.36
25 0.37
26 0.37
27 0.41
28 0.44
29 0.42
30 0.42
31 0.43
32 0.45
33 0.46
34 0.42
35 0.36
36 0.34
37 0.32
38 0.3
39 0.29
40 0.28
41 0.33
42 0.36
43 0.34
44 0.42
45 0.47
46 0.46
47 0.53
48 0.55
49 0.49
50 0.51
51 0.54
52 0.52
53 0.5
54 0.54
55 0.51
56 0.49
57 0.48
58 0.49
59 0.43
60 0.37
61 0.33
62 0.25
63 0.22
64 0.21
65 0.2
66 0.16
67 0.16
68 0.17
69 0.21
70 0.23
71 0.25
72 0.25
73 0.32
74 0.4
75 0.45
76 0.54
77 0.57
78 0.59
79 0.64
80 0.7
81 0.74
82 0.77
83 0.78
84 0.78
85 0.78
86 0.82
87 0.81
88 0.82
89 0.81
90 0.8
91 0.78
92 0.77
93 0.77
94 0.8
95 0.84
96 0.83
97 0.85
98 0.86
99 0.89