Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4BSS4

Protein Details
Accession A0A1G4BSS4   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-78LTVPSRLGRRRSRCPRQHRLNNDVSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHSTVPTSDRRLTMQQLLHQVCYPGPGTICWSLILCASNLGRLVRPLFLLILLTVPSRLGRRRSRCPRQHRLNNDVSSPSCVSWRGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.45
4 0.45
5 0.42
6 0.38
7 0.34
8 0.27
9 0.26
10 0.21
11 0.13
12 0.12
13 0.11
14 0.14
15 0.14
16 0.15
17 0.13
18 0.13
19 0.12
20 0.12
21 0.12
22 0.08
23 0.09
24 0.09
25 0.09
26 0.1
27 0.1
28 0.09
29 0.1
30 0.11
31 0.09
32 0.09
33 0.08
34 0.07
35 0.07
36 0.07
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.07
44 0.1
45 0.14
46 0.22
47 0.31
48 0.38
49 0.5
50 0.6
51 0.7
52 0.77
53 0.84
54 0.87
55 0.89
56 0.91
57 0.89
58 0.87
59 0.85
60 0.78
61 0.71
62 0.64
63 0.55
64 0.5
65 0.43
66 0.35
67 0.27
68 0.27