Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B954

Protein Details
Accession A0A1G4B954    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-192YVFFEKLRVRDRKPKGKKREEMEDEWBasic
NLS Segment(s)
PositionSequence
35-46EKPASKSRKRKS
62-76APKKQATKKKAAEKK
174-185RVRDRKPKGKKR
Subcellular Location(s) cyto 18.5, cyto_nucl 12, nucl 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPPKKAAAAAAASVPLGETDANRVVGHNKAAEPAEKPASKSRKRKSDAAADGGDDDAAAAPAPKKQATKKKAAEKKNDPLPDLSGIELHGDDDMNVPVFDTCDTVRTKIRAILKKEGVTKAAFLRAIVKAAYRAGSDHKIAPNLLTNFMNKKGPVAGNTSTVFYAAYVFFEKLRVRDRKPKGKKREEMEDEWPTGFETKELLGGPILVHASEKAYINQYGKTHVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.09
3 0.07
4 0.07
5 0.06
6 0.1
7 0.13
8 0.15
9 0.14
10 0.16
11 0.17
12 0.2
13 0.22
14 0.21
15 0.18
16 0.2
17 0.22
18 0.23
19 0.23
20 0.25
21 0.3
22 0.29
23 0.31
24 0.37
25 0.46
26 0.54
27 0.62
28 0.67
29 0.7
30 0.74
31 0.78
32 0.76
33 0.76
34 0.73
35 0.69
36 0.6
37 0.5
38 0.45
39 0.37
40 0.29
41 0.18
42 0.12
43 0.06
44 0.05
45 0.04
46 0.04
47 0.05
48 0.07
49 0.1
50 0.12
51 0.16
52 0.25
53 0.35
54 0.4
55 0.5
56 0.57
57 0.65
58 0.72
59 0.77
60 0.78
61 0.77
62 0.8
63 0.78
64 0.73
65 0.64
66 0.56
67 0.5
68 0.42
69 0.34
70 0.25
71 0.16
72 0.13
73 0.12
74 0.11
75 0.08
76 0.06
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.09
90 0.1
91 0.12
92 0.14
93 0.15
94 0.15
95 0.19
96 0.27
97 0.3
98 0.34
99 0.39
100 0.41
101 0.43
102 0.46
103 0.43
104 0.37
105 0.3
106 0.27
107 0.21
108 0.2
109 0.16
110 0.13
111 0.15
112 0.13
113 0.13
114 0.12
115 0.11
116 0.1
117 0.1
118 0.11
119 0.08
120 0.09
121 0.12
122 0.14
123 0.15
124 0.18
125 0.19
126 0.19
127 0.19
128 0.19
129 0.22
130 0.2
131 0.21
132 0.19
133 0.19
134 0.21
135 0.23
136 0.24
137 0.18
138 0.18
139 0.19
140 0.2
141 0.2
142 0.22
143 0.22
144 0.23
145 0.24
146 0.24
147 0.2
148 0.19
149 0.17
150 0.11
151 0.11
152 0.07
153 0.08
154 0.09
155 0.1
156 0.1
157 0.14
158 0.15
159 0.17
160 0.26
161 0.32
162 0.37
163 0.47
164 0.57
165 0.65
166 0.75
167 0.82
168 0.84
169 0.88
170 0.89
171 0.86
172 0.87
173 0.83
174 0.78
175 0.76
176 0.7
177 0.61
178 0.53
179 0.46
180 0.36
181 0.3
182 0.24
183 0.15
184 0.11
185 0.1
186 0.12
187 0.12
188 0.12
189 0.11
190 0.11
191 0.11
192 0.11
193 0.11
194 0.09
195 0.09
196 0.08
197 0.1
198 0.12
199 0.14
200 0.14
201 0.18
202 0.23
203 0.24
204 0.29
205 0.28