Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4AWQ6

Protein Details
Accession A0A1G4AWQ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-104AWSGIYCRRKDNKKRGGYQEKVRVSEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, cyto 6, plas 5, mito_nucl 5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036523  SurE-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0016787  F:hydrolase activity  
Amino Acid Sequences MQLRLGMYEGRFGLGKGGRPECSVCHGGTTSAVSRVKLLLLSGINLGLGLGVLFAGSVGAGCLGFLLSWFVARSNPAAAWSGIYCRRKDNKKRGGYQEKVRVSEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.26
4 0.3
5 0.3
6 0.31
7 0.33
8 0.29
9 0.32
10 0.29
11 0.23
12 0.22
13 0.21
14 0.19
15 0.19
16 0.19
17 0.14
18 0.18
19 0.19
20 0.16
21 0.17
22 0.16
23 0.16
24 0.13
25 0.12
26 0.09
27 0.08
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.06
34 0.03
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.01
43 0.01
44 0.01
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.06
59 0.07
60 0.08
61 0.09
62 0.09
63 0.1
64 0.11
65 0.11
66 0.12
67 0.12
68 0.16
69 0.22
70 0.26
71 0.26
72 0.33
73 0.42
74 0.52
75 0.62
76 0.68
77 0.71
78 0.77
79 0.86
80 0.88
81 0.9
82 0.88
83 0.87
84 0.86
85 0.83