Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B944

Protein Details
Accession A0A1G4B944    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
69-88EVVRSLPTPRPCRRGRRARRBasic
NLS Segment(s)
PositionSequence
81-88RRGRRARR
Subcellular Location(s) cyto 11.5, cysk 11, cyto_nucl 8, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MIIPEDMASVWSERKGGHEERAGEVLGQPGGFDIYVGAEEAAKGLGREVLAGRIATDDEVLRRDGVSQEVVRSLPTPRPCRRGRRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.22
4 0.27
5 0.3
6 0.32
7 0.33
8 0.34
9 0.31
10 0.25
11 0.22
12 0.18
13 0.13
14 0.1
15 0.08
16 0.06
17 0.06
18 0.06
19 0.05
20 0.04
21 0.03
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.04
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.07
38 0.07
39 0.07
40 0.06
41 0.07
42 0.06
43 0.07
44 0.06
45 0.06
46 0.08
47 0.09
48 0.09
49 0.08
50 0.09
51 0.1
52 0.11
53 0.14
54 0.14
55 0.14
56 0.16
57 0.16
58 0.16
59 0.16
60 0.17
61 0.2
62 0.28
63 0.37
64 0.43
65 0.52
66 0.59
67 0.69
68 0.77