Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4B7S8

Protein Details
Accession A0A1G4B7S8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-102DVDHQRVYRRRSERRASSRCLSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, mito 8, cyto 8, nucl 7, extr 4
Family & Domain DBs
Amino Acid Sequences MAAGGHNVFTITAISPRCARALEEIPPSRRDGGSGDTSDQLAICRADFEPNISPLEASLIETLTRPEREIVFAPKSNATADVDHQRVYRRRSERRASSRCLSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.18
4 0.19
5 0.18
6 0.18
7 0.21
8 0.23
9 0.27
10 0.34
11 0.38
12 0.4
13 0.41
14 0.42
15 0.38
16 0.34
17 0.29
18 0.23
19 0.21
20 0.23
21 0.22
22 0.22
23 0.2
24 0.2
25 0.19
26 0.17
27 0.12
28 0.09
29 0.08
30 0.06
31 0.07
32 0.07
33 0.09
34 0.09
35 0.12
36 0.12
37 0.13
38 0.14
39 0.13
40 0.12
41 0.1
42 0.11
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.1
51 0.1
52 0.1
53 0.11
54 0.12
55 0.14
56 0.17
57 0.21
58 0.23
59 0.25
60 0.26
61 0.26
62 0.26
63 0.24
64 0.23
65 0.2
66 0.16
67 0.18
68 0.24
69 0.24
70 0.25
71 0.26
72 0.32
73 0.36
74 0.39
75 0.45
76 0.48
77 0.56
78 0.65
79 0.74
80 0.77
81 0.81
82 0.85
83 0.83
84 0.79