Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4BF67

Protein Details
Accession A0A1G4BF67    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-59LSKAAPRRLRKPSKPCRHMIHydrophilic
NLS Segment(s)
PositionSequence
43-51AAPRRLRKP
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPSQRYRLADPVHDPTTIAPLGLSTGGYRESDGGLPRTGLSKAAPRRLRKPSKPCRHMIAEESLHCCTRYDGIRSTDMRRHSRETNRGFSYTSDGRQLPLAYHLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.31
4 0.25
5 0.19
6 0.12
7 0.1
8 0.1
9 0.1
10 0.1
11 0.05
12 0.06
13 0.07
14 0.08
15 0.08
16 0.08
17 0.09
18 0.1
19 0.12
20 0.14
21 0.13
22 0.13
23 0.13
24 0.14
25 0.13
26 0.12
27 0.11
28 0.17
29 0.21
30 0.3
31 0.36
32 0.39
33 0.47
34 0.56
35 0.65
36 0.67
37 0.73
38 0.75
39 0.79
40 0.81
41 0.77
42 0.72
43 0.67
44 0.6
45 0.52
46 0.47
47 0.39
48 0.35
49 0.35
50 0.3
51 0.26
52 0.24
53 0.21
54 0.15
55 0.16
56 0.18
57 0.19
58 0.23
59 0.25
60 0.31
61 0.33
62 0.37
63 0.38
64 0.42
65 0.45
66 0.44
67 0.47
68 0.5
69 0.57
70 0.62
71 0.64
72 0.65
73 0.63
74 0.6
75 0.56
76 0.48
77 0.46
78 0.41
79 0.36
80 0.33
81 0.29
82 0.28
83 0.3
84 0.29
85 0.23
86 0.27