Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4B7C4

Protein Details
Accession A0A1G4B7C4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-65EVTESKPQPRAPRRRTTGKFREELDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001171  ERG24_DHCR-like  
IPR018083  Sterol_reductase_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0016628  F:oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor  
GO:0016126  P:sterol biosynthetic process  
Pfam View protein in Pfam  
PF01222  ERG4_ERG24  
PROSITE View protein in PROSITE  
PS01017  STEROL_REDUCT_1  
Amino Acid Sequences MTGRYSLRQTPRKKELFEGMVETPRRVSSRRKSPETTTGAEVTESKPQPRAPRRRTTGKFREELDDEVETATANGKADLDEPLTNGHTNGYTNGHVKEEPVANGHTNGYTQVKVEAAANGHAAKSVEEEAQPVYKKGNIIDGWEVGTDPKIDASGEFEFGGSVGTMSLMIGFPLLMWYMWIGATYYNGGVPTREEGQSWGEFGRHLVDLVYTGAFPSLRAWRIYWTFFIFEGICYCVLPGVWAWGKPLAHENGKQLKYFCNAYVSFYFTIAVMAVLHFTGVFPLYTFLDEFGPLMSVAILSGFLVAFVAYFSALWRGAQHRMTGYPIYDFFLGAELNPRMFGILDFKMFFEVRIPWFILFGLSCGAAARQYEKYGYVSGEVLFLVMAHYLYANACAKGEQLIVPTWDMYYEKWGFMLIFWNLAGVPLSYCHCTIFLANHHPSEYKWNPIALGLLFASYLFVYWIWDTTNSQKNGFRAQERGQLVARKTFPQLPWQTVKNPKTITSAKGDVILADGWYGYARKIHYTCDAFFAICWGLITGFKSPFPWFYPVFFCGMIAHRAARDIHRCRQKYGDAWTQYEREVPYLFIPYVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.68
4 0.62
5 0.57
6 0.5
7 0.51
8 0.49
9 0.43
10 0.35
11 0.34
12 0.34
13 0.32
14 0.38
15 0.41
16 0.51
17 0.6
18 0.66
19 0.69
20 0.73
21 0.79
22 0.75
23 0.69
24 0.62
25 0.54
26 0.46
27 0.42
28 0.36
29 0.28
30 0.31
31 0.3
32 0.28
33 0.3
34 0.34
35 0.44
36 0.53
37 0.62
38 0.62
39 0.71
40 0.77
41 0.83
42 0.86
43 0.86
44 0.86
45 0.84
46 0.8
47 0.72
48 0.71
49 0.62
50 0.57
51 0.5
52 0.4
53 0.32
54 0.27
55 0.24
56 0.16
57 0.14
58 0.13
59 0.1
60 0.09
61 0.09
62 0.08
63 0.09
64 0.1
65 0.12
66 0.14
67 0.13
68 0.13
69 0.15
70 0.17
71 0.17
72 0.16
73 0.15
74 0.13
75 0.14
76 0.15
77 0.16
78 0.17
79 0.2
80 0.21
81 0.22
82 0.21
83 0.21
84 0.24
85 0.24
86 0.22
87 0.22
88 0.23
89 0.22
90 0.23
91 0.23
92 0.18
93 0.16
94 0.17
95 0.17
96 0.15
97 0.14
98 0.14
99 0.13
100 0.14
101 0.14
102 0.14
103 0.12
104 0.13
105 0.14
106 0.13
107 0.13
108 0.14
109 0.13
110 0.11
111 0.12
112 0.13
113 0.13
114 0.12
115 0.13
116 0.14
117 0.18
118 0.19
119 0.17
120 0.17
121 0.17
122 0.18
123 0.18
124 0.24
125 0.2
126 0.22
127 0.24
128 0.23
129 0.22
130 0.21
131 0.2
132 0.13
133 0.13
134 0.1
135 0.08
136 0.07
137 0.07
138 0.07
139 0.07
140 0.11
141 0.11
142 0.12
143 0.11
144 0.11
145 0.11
146 0.1
147 0.11
148 0.06
149 0.05
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.04
161 0.04
162 0.03
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.04
170 0.05
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.07
177 0.08
178 0.1
179 0.12
180 0.12
181 0.12
182 0.13
183 0.17
184 0.17
185 0.17
186 0.15
187 0.12
188 0.12
189 0.12
190 0.12
191 0.09
192 0.09
193 0.08
194 0.07
195 0.07
196 0.08
197 0.08
198 0.06
199 0.05
200 0.06
201 0.06
202 0.06
203 0.08
204 0.11
205 0.13
206 0.14
207 0.15
208 0.19
209 0.22
210 0.23
211 0.23
212 0.2
213 0.2
214 0.19
215 0.2
216 0.16
217 0.13
218 0.12
219 0.11
220 0.09
221 0.08
222 0.08
223 0.06
224 0.06
225 0.06
226 0.05
227 0.08
228 0.09
229 0.09
230 0.1
231 0.13
232 0.13
233 0.13
234 0.17
235 0.17
236 0.19
237 0.21
238 0.27
239 0.34
240 0.35
241 0.36
242 0.33
243 0.32
244 0.31
245 0.31
246 0.25
247 0.21
248 0.19
249 0.22
250 0.22
251 0.22
252 0.2
253 0.18
254 0.17
255 0.12
256 0.12
257 0.09
258 0.08
259 0.04
260 0.04
261 0.04
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.05
271 0.05
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.06
278 0.05
279 0.05
280 0.05
281 0.05
282 0.04
283 0.03
284 0.03
285 0.03
286 0.03
287 0.02
288 0.03
289 0.02
290 0.02
291 0.02
292 0.02
293 0.02
294 0.02
295 0.02
296 0.02
297 0.02
298 0.03
299 0.04
300 0.04
301 0.05
302 0.06
303 0.09
304 0.12
305 0.14
306 0.15
307 0.14
308 0.15
309 0.17
310 0.17
311 0.15
312 0.13
313 0.12
314 0.12
315 0.11
316 0.1
317 0.08
318 0.08
319 0.08
320 0.06
321 0.1
322 0.08
323 0.08
324 0.08
325 0.08
326 0.07
327 0.08
328 0.08
329 0.08
330 0.09
331 0.1
332 0.11
333 0.11
334 0.13
335 0.13
336 0.12
337 0.1
338 0.12
339 0.12
340 0.14
341 0.14
342 0.12
343 0.13
344 0.13
345 0.11
346 0.09
347 0.08
348 0.06
349 0.05
350 0.05
351 0.05
352 0.05
353 0.05
354 0.06
355 0.08
356 0.09
357 0.1
358 0.11
359 0.12
360 0.13
361 0.14
362 0.14
363 0.12
364 0.12
365 0.11
366 0.11
367 0.09
368 0.08
369 0.06
370 0.06
371 0.05
372 0.04
373 0.04
374 0.03
375 0.03
376 0.04
377 0.04
378 0.07
379 0.08
380 0.08
381 0.09
382 0.09
383 0.09
384 0.1
385 0.11
386 0.08
387 0.09
388 0.1
389 0.11
390 0.11
391 0.11
392 0.1
393 0.1
394 0.1
395 0.08
396 0.14
397 0.14
398 0.14
399 0.14
400 0.14
401 0.13
402 0.13
403 0.17
404 0.1
405 0.1
406 0.1
407 0.1
408 0.1
409 0.1
410 0.1
411 0.06
412 0.06
413 0.06
414 0.08
415 0.1
416 0.1
417 0.1
418 0.1
419 0.11
420 0.11
421 0.14
422 0.17
423 0.24
424 0.26
425 0.27
426 0.28
427 0.28
428 0.27
429 0.33
430 0.31
431 0.29
432 0.28
433 0.28
434 0.27
435 0.27
436 0.28
437 0.18
438 0.17
439 0.11
440 0.09
441 0.08
442 0.08
443 0.08
444 0.06
445 0.06
446 0.05
447 0.05
448 0.06
449 0.06
450 0.07
451 0.08
452 0.09
453 0.12
454 0.19
455 0.27
456 0.28
457 0.31
458 0.34
459 0.35
460 0.42
461 0.45
462 0.41
463 0.39
464 0.42
465 0.47
466 0.45
467 0.45
468 0.41
469 0.42
470 0.41
471 0.41
472 0.4
473 0.34
474 0.36
475 0.39
476 0.37
477 0.41
478 0.44
479 0.44
480 0.47
481 0.48
482 0.53
483 0.56
484 0.58
485 0.56
486 0.53
487 0.49
488 0.51
489 0.51
490 0.47
491 0.44
492 0.44
493 0.37
494 0.38
495 0.35
496 0.27
497 0.25
498 0.21
499 0.14
500 0.1
501 0.09
502 0.07
503 0.08
504 0.08
505 0.07
506 0.1
507 0.11
508 0.18
509 0.2
510 0.23
511 0.31
512 0.35
513 0.35
514 0.37
515 0.37
516 0.3
517 0.28
518 0.28
519 0.2
520 0.15
521 0.15
522 0.1
523 0.1
524 0.11
525 0.13
526 0.15
527 0.16
528 0.17
529 0.19
530 0.2
531 0.24
532 0.26
533 0.29
534 0.27
535 0.28
536 0.33
537 0.32
538 0.33
539 0.29
540 0.26
541 0.23
542 0.24
543 0.23
544 0.2
545 0.21
546 0.18
547 0.21
548 0.23
549 0.28
550 0.36
551 0.4
552 0.48
553 0.57
554 0.59
555 0.61
556 0.66
557 0.66
558 0.62
559 0.63
560 0.64
561 0.59
562 0.61
563 0.62
564 0.56
565 0.5
566 0.48
567 0.4
568 0.33
569 0.29
570 0.26
571 0.23
572 0.25