Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NVW6

Protein Details
Accession C0NVW6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
30-55YVPEIVRKEKRKEKKKEEEKGPLNKABasic
NLS Segment(s)
PositionSequence
36-50RKEKRKEKKKEEEKG
Subcellular Location(s) mito 17, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MNPSRTGGATYSHGKKCDVQGQDVGLWLQYVPEIVRKEKRKEKKKEEEKGPLNKASNENAGWFLADGKGPEVSYGRPLHGFITK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.41
4 0.44
5 0.4
6 0.35
7 0.33
8 0.34
9 0.32
10 0.3
11 0.24
12 0.16
13 0.14
14 0.1
15 0.07
16 0.05
17 0.05
18 0.04
19 0.09
20 0.11
21 0.15
22 0.23
23 0.29
24 0.37
25 0.47
26 0.57
27 0.62
28 0.71
29 0.78
30 0.81
31 0.86
32 0.87
33 0.86
34 0.86
35 0.84
36 0.83
37 0.77
38 0.71
39 0.62
40 0.56
41 0.5
42 0.43
43 0.38
44 0.29
45 0.26
46 0.22
47 0.2
48 0.16
49 0.14
50 0.12
51 0.09
52 0.09
53 0.08
54 0.08
55 0.1
56 0.09
57 0.11
58 0.12
59 0.12
60 0.18
61 0.19
62 0.21
63 0.21
64 0.22