Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4BPU8

Protein Details
Accession A0A1G4BPU8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
52-74GGMNRNRCRPVRRRWAWRVSAGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 5.5, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences AATLEPKTDRASRNRQKPIGDPAIKISDNRSLPRQACLQDCLHLANDGLRAGGMNRNRCRPVRRRWAWRVSAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.7
4 0.69
5 0.7
6 0.69
7 0.62
8 0.52
9 0.47
10 0.47
11 0.44
12 0.39
13 0.32
14 0.28
15 0.28
16 0.29
17 0.28
18 0.28
19 0.28
20 0.31
21 0.32
22 0.27
23 0.26
24 0.27
25 0.25
26 0.21
27 0.21
28 0.19
29 0.16
30 0.14
31 0.12
32 0.11
33 0.11
34 0.09
35 0.08
36 0.07
37 0.06
38 0.07
39 0.13
40 0.16
41 0.25
42 0.29
43 0.36
44 0.41
45 0.47
46 0.55
47 0.59
48 0.64
49 0.66
50 0.72
51 0.76
52 0.81
53 0.86
54 0.84