Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VQR3

Protein Details
Accession A0A1D2VQR3   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45ININRLKRPRNVKSVKDLKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029012  Helix_hairpin_bin_sf  
IPR009360  Isy1  
IPR037200  Isy1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000350  P:generation of catalytic spliceosome for second transesterification step  
Pfam View protein in Pfam  
PF06246  Isy1  
Amino Acid Sequences MSRNSEKAQSLLFKYQEFKALEKGYININRLKRPRNVKSVKDLKLSEKWRNQVLGEISRKITLIQDEMLSDYQIRDLNDEINKLMREKLAWEYHIKEIGGPDYIRFSKKQNQNYSNEFVIRGYRYFGRAKHLPDVQELIKQQATEKQSNLKIFENEKSNKKLIYERLNRIDAEYYGLYEHDVNSEIAYSINKNQKNIYDQILDILGSEYIANDNKYKIMQENNLKISDSLENLDLNDHTNPDGKNFYNDELLNAEDDLSKKLFLKLKNNYNSNDKLINNSDDLSIIDIDNDEDPHQVPTLQEIENFILNRKKKLMKIEVNSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.43
4 0.39
5 0.35
6 0.36
7 0.37
8 0.36
9 0.34
10 0.34
11 0.34
12 0.38
13 0.39
14 0.38
15 0.41
16 0.48
17 0.54
18 0.6
19 0.6
20 0.64
21 0.7
22 0.74
23 0.77
24 0.75
25 0.78
26 0.81
27 0.79
28 0.76
29 0.7
30 0.66
31 0.66
32 0.66
33 0.66
34 0.63
35 0.62
36 0.59
37 0.58
38 0.52
39 0.49
40 0.48
41 0.47
42 0.44
43 0.42
44 0.38
45 0.36
46 0.36
47 0.3
48 0.27
49 0.2
50 0.17
51 0.16
52 0.15
53 0.15
54 0.17
55 0.17
56 0.14
57 0.13
58 0.1
59 0.12
60 0.13
61 0.13
62 0.12
63 0.13
64 0.18
65 0.19
66 0.2
67 0.18
68 0.2
69 0.2
70 0.2
71 0.2
72 0.16
73 0.15
74 0.16
75 0.22
76 0.23
77 0.24
78 0.27
79 0.28
80 0.3
81 0.33
82 0.3
83 0.24
84 0.21
85 0.2
86 0.19
87 0.16
88 0.14
89 0.16
90 0.18
91 0.19
92 0.19
93 0.23
94 0.29
95 0.37
96 0.46
97 0.52
98 0.57
99 0.61
100 0.65
101 0.64
102 0.57
103 0.5
104 0.41
105 0.31
106 0.27
107 0.22
108 0.17
109 0.15
110 0.14
111 0.17
112 0.2
113 0.21
114 0.24
115 0.27
116 0.3
117 0.33
118 0.35
119 0.32
120 0.31
121 0.33
122 0.27
123 0.27
124 0.24
125 0.21
126 0.19
127 0.17
128 0.17
129 0.19
130 0.22
131 0.21
132 0.22
133 0.25
134 0.29
135 0.31
136 0.32
137 0.29
138 0.27
139 0.27
140 0.3
141 0.31
142 0.31
143 0.34
144 0.36
145 0.35
146 0.32
147 0.32
148 0.33
149 0.32
150 0.38
151 0.41
152 0.43
153 0.46
154 0.48
155 0.46
156 0.42
157 0.37
158 0.27
159 0.22
160 0.16
161 0.11
162 0.1
163 0.1
164 0.09
165 0.08
166 0.08
167 0.06
168 0.07
169 0.07
170 0.06
171 0.07
172 0.06
173 0.06
174 0.07
175 0.07
176 0.12
177 0.19
178 0.21
179 0.21
180 0.23
181 0.26
182 0.3
183 0.31
184 0.29
185 0.23
186 0.22
187 0.22
188 0.2
189 0.17
190 0.13
191 0.11
192 0.07
193 0.05
194 0.05
195 0.04
196 0.06
197 0.07
198 0.08
199 0.09
200 0.09
201 0.1
202 0.11
203 0.12
204 0.14
205 0.17
206 0.24
207 0.31
208 0.37
209 0.39
210 0.4
211 0.39
212 0.36
213 0.33
214 0.28
215 0.21
216 0.15
217 0.13
218 0.13
219 0.12
220 0.13
221 0.11
222 0.12
223 0.11
224 0.1
225 0.1
226 0.14
227 0.14
228 0.16
229 0.19
230 0.18
231 0.22
232 0.24
233 0.25
234 0.25
235 0.25
236 0.24
237 0.22
238 0.21
239 0.17
240 0.15
241 0.14
242 0.11
243 0.12
244 0.13
245 0.12
246 0.12
247 0.13
248 0.19
249 0.24
250 0.28
251 0.37
252 0.44
253 0.53
254 0.61
255 0.65
256 0.64
257 0.66
258 0.64
259 0.59
260 0.56
261 0.46
262 0.43
263 0.42
264 0.41
265 0.35
266 0.32
267 0.27
268 0.22
269 0.21
270 0.18
271 0.14
272 0.11
273 0.1
274 0.09
275 0.1
276 0.1
277 0.11
278 0.1
279 0.11
280 0.11
281 0.13
282 0.13
283 0.13
284 0.12
285 0.15
286 0.18
287 0.18
288 0.18
289 0.19
290 0.21
291 0.25
292 0.25
293 0.25
294 0.3
295 0.32
296 0.36
297 0.41
298 0.46
299 0.47
300 0.57
301 0.63
302 0.65