Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2V910

Protein Details
Accession A0A1D2V910    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-54AETNFNKRKEERGKRKKRTVYCCFYHHydrophilic
NLS Segment(s)
PositionSequence
35-46KRKEERGKRKKR
Subcellular Location(s) E.R. 5, plas 4, extr 4, pero 4, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MLSVFCFLFFAFCYLCLLPSLLCCSTITAETNFNKRKEERGKRKKRTVYCCFYHIHHQLSHPTDFHLLPPRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.12
5 0.1
6 0.11
7 0.15
8 0.12
9 0.12
10 0.12
11 0.13
12 0.13
13 0.14
14 0.15
15 0.12
16 0.17
17 0.18
18 0.27
19 0.31
20 0.31
21 0.33
22 0.32
23 0.4
24 0.45
25 0.54
26 0.58
27 0.64
28 0.74
29 0.8
30 0.9
31 0.9
32 0.89
33 0.88
34 0.86
35 0.83
36 0.76
37 0.7
38 0.62
39 0.56
40 0.56
41 0.51
42 0.45
43 0.39
44 0.38
45 0.41
46 0.43
47 0.43
48 0.34
49 0.32
50 0.31
51 0.29
52 0.31