Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VL19

Protein Details
Accession A0A1D2VL19   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
165-186LKQLDEKTKKWKENYKISNTTQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 10.333, cyto_nucl 9.833, mito 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006797  PRELI/MSF1_dom  
IPR037365  Slowmo/Ups  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005758  C:mitochondrial intermembrane space  
Pfam View protein in Pfam  
PF04707  PRELI  
PROSITE View protein in PROSITE  
PS50904  PRELI_MSF1  
Amino Acid Sequences MVLWYKNGNEYNYNFQTVSLAIYNKYPNPFSTHVLSVDTIENRIDSEGNLHRTRLIMKEGRLPIWAKPFLKNINRSWIIEKSIVNPQKKIMKLYTRNLDHTRILKIEEYSKYYFDSIIKKTIVKSQVKFSSTFKGLGIKDRIEKWSHKRFDDNIKKSSNGLLYVLKQLDEKTKKWKENYKISNTTQIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.31
4 0.26
5 0.25
6 0.18
7 0.16
8 0.14
9 0.18
10 0.21
11 0.23
12 0.27
13 0.25
14 0.24
15 0.29
16 0.32
17 0.32
18 0.33
19 0.32
20 0.29
21 0.3
22 0.29
23 0.24
24 0.24
25 0.21
26 0.17
27 0.15
28 0.14
29 0.13
30 0.13
31 0.11
32 0.08
33 0.12
34 0.17
35 0.23
36 0.24
37 0.24
38 0.23
39 0.24
40 0.26
41 0.23
42 0.25
43 0.23
44 0.23
45 0.31
46 0.33
47 0.33
48 0.33
49 0.32
50 0.28
51 0.31
52 0.35
53 0.28
54 0.29
55 0.33
56 0.38
57 0.43
58 0.46
59 0.41
60 0.46
61 0.46
62 0.45
63 0.44
64 0.38
65 0.34
66 0.31
67 0.29
68 0.23
69 0.29
70 0.34
71 0.31
72 0.29
73 0.3
74 0.34
75 0.34
76 0.34
77 0.31
78 0.34
79 0.39
80 0.44
81 0.49
82 0.45
83 0.49
84 0.49
85 0.47
86 0.41
87 0.37
88 0.33
89 0.25
90 0.24
91 0.2
92 0.19
93 0.21
94 0.2
95 0.22
96 0.22
97 0.22
98 0.21
99 0.2
100 0.2
101 0.18
102 0.22
103 0.19
104 0.22
105 0.22
106 0.22
107 0.23
108 0.29
109 0.34
110 0.35
111 0.35
112 0.39
113 0.44
114 0.45
115 0.46
116 0.42
117 0.41
118 0.37
119 0.36
120 0.28
121 0.28
122 0.27
123 0.32
124 0.34
125 0.29
126 0.32
127 0.33
128 0.36
129 0.34
130 0.4
131 0.42
132 0.48
133 0.51
134 0.5
135 0.54
136 0.56
137 0.63
138 0.67
139 0.65
140 0.61
141 0.59
142 0.57
143 0.52
144 0.51
145 0.43
146 0.33
147 0.29
148 0.26
149 0.25
150 0.29
151 0.29
152 0.25
153 0.23
154 0.23
155 0.31
156 0.33
157 0.34
158 0.39
159 0.48
160 0.55
161 0.63
162 0.71
163 0.7
164 0.76
165 0.83
166 0.82
167 0.82
168 0.78