Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1G8K8

Protein Details
Accession C1G8K8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-29ARHHEERVKKAKKYARKEEVRKFFCRRSBasic
NLS Segment(s)
PositionSequence
8-19RVKKAKKYARKE
Subcellular Location(s) mito 11.5, mito_nucl 10.5, nucl 8.5, cyto 7
Family & Domain DBs
KEGG pbn:PADG_03594  -  
Amino Acid Sequences MARHHEERVKKAKKYARKEEVRKFFCRRSIPPGEPLLDEQLVIGKVILVHMHRLGLSRKVEFEAEEVKYVSATKLEGDCIGAESVNVTSVLLLLQSSPDRAVIDMFEKRRSAHYHGSIKTGQPPNKKKLFIGTLRVNDRAYGRPAGTNTEFNVFSLAAFTCKIDALTSDPRRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.8
4 0.82
5 0.88
6 0.89
7 0.91
8 0.87
9 0.85
10 0.81
11 0.77
12 0.74
13 0.72
14 0.66
15 0.64
16 0.67
17 0.62
18 0.61
19 0.58
20 0.52
21 0.46
22 0.43
23 0.38
24 0.29
25 0.25
26 0.18
27 0.16
28 0.14
29 0.13
30 0.11
31 0.07
32 0.06
33 0.07
34 0.09
35 0.07
36 0.09
37 0.09
38 0.1
39 0.1
40 0.12
41 0.14
42 0.18
43 0.2
44 0.19
45 0.2
46 0.21
47 0.21
48 0.19
49 0.19
50 0.18
51 0.16
52 0.16
53 0.15
54 0.14
55 0.14
56 0.14
57 0.11
58 0.07
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.08
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.02
81 0.04
82 0.04
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.09
91 0.14
92 0.15
93 0.18
94 0.18
95 0.19
96 0.23
97 0.27
98 0.29
99 0.33
100 0.39
101 0.45
102 0.46
103 0.5
104 0.47
105 0.44
106 0.47
107 0.47
108 0.44
109 0.46
110 0.53
111 0.56
112 0.62
113 0.62
114 0.54
115 0.54
116 0.56
117 0.51
118 0.52
119 0.52
120 0.52
121 0.54
122 0.56
123 0.48
124 0.42
125 0.39
126 0.35
127 0.31
128 0.27
129 0.24
130 0.25
131 0.26
132 0.31
133 0.31
134 0.3
135 0.28
136 0.29
137 0.28
138 0.24
139 0.25
140 0.18
141 0.15
142 0.14
143 0.13
144 0.1
145 0.1
146 0.11
147 0.09
148 0.1
149 0.1
150 0.09
151 0.1
152 0.15
153 0.25
154 0.32