Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D2VI14

Protein Details
Accession A0A1D2VI14    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
211-230LDRERHKKLKESKWMVNRLDBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR042326  Ctk3  
IPR024637  Ctk3_C  
IPR024638  Ctk3_N  
IPR008942  ENTH_VHS  
Gene Ontology GO:0070692  C:CTDK-1 complex  
GO:0032786  P:positive regulation of DNA-templated transcription, elongation  
Pfam View protein in Pfam  
PF12243  CTK3  
PF12350  CTK3_C  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MDAFEARLEFSKKLFNLIPSSVIISSCVNFALRYCDYQDDFNSCIIEVLSQVDLNQKLNILYFIEALLLHPQLQINKDITTFPPYLLDILRALPNYLITIIPSHHGGLSNLRVAFSILQNIGNNFLTLDPPIDLDKNTDKNLENFSSDLNLLNSLKISNDSLNKNIHSFDNLNANLINNSNTQKETKINYEDIIYQQFPVSGGKILARMELDRERHKKLKESKWMVNRLDKAVDKNEFRYLWDKYDELSDDDIDRIEELNDLARDSYNYPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.34
4 0.34
5 0.35
6 0.28
7 0.31
8 0.26
9 0.23
10 0.21
11 0.17
12 0.16
13 0.14
14 0.13
15 0.11
16 0.11
17 0.11
18 0.16
19 0.16
20 0.18
21 0.2
22 0.25
23 0.26
24 0.29
25 0.31
26 0.28
27 0.28
28 0.27
29 0.25
30 0.2
31 0.18
32 0.15
33 0.13
34 0.09
35 0.09
36 0.09
37 0.08
38 0.08
39 0.13
40 0.14
41 0.15
42 0.15
43 0.14
44 0.14
45 0.14
46 0.15
47 0.11
48 0.1
49 0.09
50 0.09
51 0.09
52 0.08
53 0.08
54 0.1
55 0.09
56 0.08
57 0.09
58 0.1
59 0.12
60 0.13
61 0.16
62 0.15
63 0.16
64 0.16
65 0.17
66 0.17
67 0.2
68 0.19
69 0.16
70 0.16
71 0.16
72 0.16
73 0.15
74 0.15
75 0.1
76 0.11
77 0.13
78 0.11
79 0.11
80 0.1
81 0.1
82 0.09
83 0.09
84 0.08
85 0.06
86 0.07
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.11
95 0.13
96 0.15
97 0.14
98 0.14
99 0.13
100 0.13
101 0.14
102 0.11
103 0.12
104 0.09
105 0.1
106 0.1
107 0.11
108 0.12
109 0.11
110 0.11
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.05
117 0.06
118 0.07
119 0.07
120 0.07
121 0.09
122 0.13
123 0.15
124 0.16
125 0.18
126 0.18
127 0.19
128 0.23
129 0.22
130 0.18
131 0.16
132 0.15
133 0.14
134 0.13
135 0.12
136 0.08
137 0.09
138 0.08
139 0.08
140 0.08
141 0.07
142 0.07
143 0.07
144 0.08
145 0.09
146 0.14
147 0.16
148 0.19
149 0.21
150 0.22
151 0.22
152 0.22
153 0.19
154 0.18
155 0.18
156 0.16
157 0.22
158 0.21
159 0.21
160 0.2
161 0.2
162 0.17
163 0.16
164 0.16
165 0.11
166 0.13
167 0.13
168 0.15
169 0.15
170 0.17
171 0.2
172 0.22
173 0.25
174 0.28
175 0.27
176 0.27
177 0.27
178 0.27
179 0.25
180 0.26
181 0.2
182 0.17
183 0.15
184 0.15
185 0.14
186 0.13
187 0.12
188 0.09
189 0.09
190 0.1
191 0.12
192 0.12
193 0.13
194 0.13
195 0.12
196 0.16
197 0.21
198 0.25
199 0.33
200 0.37
201 0.43
202 0.49
203 0.52
204 0.57
205 0.61
206 0.66
207 0.68
208 0.71
209 0.73
210 0.76
211 0.82
212 0.78
213 0.76
214 0.7
215 0.63
216 0.6
217 0.54
218 0.49
219 0.48
220 0.49
221 0.44
222 0.43
223 0.46
224 0.4
225 0.41
226 0.42
227 0.38
228 0.35
229 0.35
230 0.33
231 0.27
232 0.32
233 0.3
234 0.27
235 0.26
236 0.23
237 0.21
238 0.21
239 0.2
240 0.15
241 0.14
242 0.12
243 0.1
244 0.09
245 0.08
246 0.13
247 0.13
248 0.14
249 0.14
250 0.14
251 0.16
252 0.17